KEGG   Vibrio vulnificus YJ016: VVA0979Help
Entry
VVA0979           CDS       T00150                                 

Definition
(GenBank) uncharacterized hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VVA0979
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVA0979
Secretion system [BR:vvy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVA0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: BAC97005
UniProt: Q7MDQ7
Position
II:complement(1088630..1089109)
Genome map
AA seq 159 aa AA seqDB search
MQSNTYLKYADIKGEATAEQYKDMITLLSVDWSVGREISSYTGTAMDREASSTRLYDMTI
TKLQDKASPDLFKEATIGKGKPAVFHITKQGEKIEEIMKIQLTDAMISNYAVSIQDDRPI
ETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaaatacctacctgaaatatgctgatattaaaggtgaagctaccgcagaacag
tacaaggatatgattactcttctttcagttgattggagtgtaggtcgtgaaatttcttct
tatactggtaccgcaatggatcgtgaagcaagctctactcgtctttacgatatgaccatt
accaaacttcaagacaaagcatccccagatctgttcaaagaagccacgattggtaagggt
aaacccgctgtattccatatcactaagcagggtgaaaaaatcgaagaaatcatgaaaatt
caactaacagatgccatgatttctaactatgcagtgtcaattcaagacgaccgtccaatt
gaaacaatcaccatttcttacacagagatgatgatgacggtgacgcctactgatgacaaa
aacaacacatctgctccgttggtatacggttacagcggtgttaaaggtcaacaaatgtaa

DBGET integrated database retrieval system