KEGG   Vibrio vulnificus YJ016: VVA0986
Entry
VVA0986           CDS       T00150                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11900  type VI secretion system protein ImpC
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVA0986
Secretion system [BR:vvy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVA0986
SSDB
Motif
Pfam: VipB VipB_2 CBX7_C
Other DBs
NCBI-ProteinID: BAC97012
UniProt: Q7MDQ0
Position
II:complement(1097513..1099006)
AA seq 497 aa
MTTQLETQLDPTVEGQSFSFLEQAIGATKQTEASRAEELIKTLTEEALKGTVTWNKNLTV
TFREAITALDKKISEQLSAVMHHPELQKLEGTWRGLNYLVMNSETSSTLKIRMVSMTKKE
LHKDLSKAVEFDQSQVFKKVYESEFGSAGGEPYGAIIGDYEFTNHPEDIETLRLMSNVAA
AGFSPFLSAASPALFGFDEWTELSKPRDLEKVFESLEYTQWRAFRESQDSRFVSLTMPKV
LARLPYGQATSPVEEFGFEEFSVDETTGIAVNAQHNDYCWMNSSYVLGAKLTDAFAKYGF
CTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRRESELGKLGFLPLCHYKNT
NYAVFFGAQTCQKPAKYDSPDATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVREVPGAPGAYNAVAWLKPWLQME
ELTTSLRLVAKIPQSGG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacaacacagcttgaaacccaattagaccccaccgttgaaggccagagtttttccttc
ctcgaacaagcgattggcgcgaccaaacaaacggaagcgtcgagagcagaagagttaatc
aaaacattaacagaagaagctttaaaaggtacggtaacgtggaacaaaaacctaaccgtg
acgtttcgtgaagccattaccgctttggacaaaaagatttccgaacagctgtctgcggtg
atgcatcaccctgagttgcaaaagttggaaggaacgtggcgtgggttgaattatctggtg
atgaattcggaaacgagctccacgttaaagattcgtatggtgagtatgaccaagaaagag
ctgcacaaagatttaagtaaagcagtggagttcgatcaaagccaggtcttcaagaaagtc
tacgaatcagaatttggtagtgctggtggtgagccatatggtgcgatcattggtgactat
gaatttacgaatcatccagaagatattgaaacgctgcgtcttatgtcgaatgttgcggca
gctggtttttctccattcctttctgccgcctcacctgcgttgtttggttttgacgaatgg
acggaattgtcgaagcctagagatttagagaaagtatttgagtcgctcgagtacactcag
tggcgcgcattccgtgaaagccaagactcacgctttgtcagcttgacgatgccgaaagtc
cttgctcgacttccttatggacaagcgacatcgccagtcgaagagtttggttttgaagag
ttttccgtagacgaaaccaccggaattgcggtgaatgcgcagcacaacgactactgctgg
atgaactcgtcgtatgtactgggagcgaagctcactgacgcatttgccaagtatggattc
tgcacggcaattcgtggtgctgagggtggtggtcgtgtcgacaatctgccaacgcacttc
tttatgagtgacgatggcgatccagatatgaaatgcccgaccgaaattggcattactgac
cgtcgtgaatccgagttaggtaaactgggcttcctgcctttatgtcactataagaatacc
aactacgccgtattctttggtgcgcaaacctgccaaaaaccagccaaatacgattcgcca
gatgccacagcgaatgctgcgatttctgcgcgcttgccttacatgatggcgacctctcgt
tttgcgcattatctcaaggtcatggcgcgagataagattggtagcttcatggaagcagaa
gacgttgagtcatggctaaatcgatggatccttggctacgtcaacgcgtcggaaggcggt
ggtcaagagatccgtgcgaaatacccgttggcggatgcgcgagtgcaggtcagagaagtt
cctggcgcaccgggtgcttacaacgctgttgcgtggcttaagccttggctgcaaatggaa
gagcttacaacgtctctccgtttggtagcgaaaatccctcagtctggcggataa

DBGET integrated database retrieval system