KEGG   Vibrio vulnificus YJ016: VVA0987Help
Entry
VVA0987           CDS       T00150                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11901  type VI secretion system protein ImpB
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVA0987
Secretion system [BR:vvy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVA0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA RNase_H_2
Motif
Other DBs
NCBI-ProteinID: BAC97013
UniProt: Q7MDP9
Position
II:complement(1099018..1099530)
Genome map
AA seq 170 aa AA seqDB search
MTSIHSKLSRVRKPRVHITYDVETEGTSLKKELPFVVGVMGDFAGQNTEALKPLKDRRFI
QIDRDNFDDVLKKMSPSVEFKVKNTMVDDGTEFAVNLQFQSMKDFEPASIVRQVDPLRQL
MDTRNKLRDLMTKVDRSEELENVLEAVLNNTDNLSKLADELKLGQEEKAE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgactagtatccactcgaaattatcgcgagtacggaagccacgtgttcatattacctat
gatgttgaaacagaaggcacatcactgaagaaagaacttccgtttgtagtgggtgtgatg
ggggattttgctggccaaaatactgaagccctcaaaccactaaaagaccgtcgttttatt
caaattgatcgagacaactttgatgatgtactcaagaaaatgagtccatcagtggagttt
aaagtgaaaaacacgatggtggatgacggaacggaatttgcggtcaatctgcagttccaa
tcgatgaaggatttcgaacccgcctcgattgttagacaagttgatccgcttcgtcaattg
atggacacacgcaataaattgcgcgacctaatgaccaaagttgaccgttcagaagagcta
gaaaacgtgcttgaagcggttttgaacaacaccgacaacctatctaaattggcagatgaa
ctcaagttaggccaagaagagaaagcggagtaa

DBGET integrated database retrieval system