KEGG   Vibrio vulnificus YJ016: VVA0992
Entry
VVA0992           CDS       T00150                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11892  type VI secretion system protein ImpK
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VVA0992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVA0992
Secretion system [BR:vvy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVA0992
SSDB
Motif
Pfam: DotU OmpA Spore_YhaL
Other DBs
NCBI-ProteinID: BAC97018
UniProt: Q7MDP4
Position
II:complement(1105664..1106992)
AA seq 442 aa
MDETIVKPTPGRKKAPQSTPVASLESDNTVLFTQNSKETRETSIVAFGNNVLLAEANVIV
SLLGQIRATATHSDVKQLREAFVQKMRDYENRLRLQGANSKQIDIARYCLCCAIDEAVLN
TEWGSQSVWGHNSLLSTFYSNTQGGEQFFIHLDESLAEPNKHLDLLEVMYICMSLGFLGQ
FRVRENGIEQHRSLKNRVMDVLKSHGRDYSPSLNDGALAKVLVGEQIAEKAPLWVVLSIT
AAVLASVYMYLSYSLNEKSDQTFSQLMNLVPSKEIENQSADYISSLAVANQIQRSLATEI
EMGLLKVDALPDRVRITFQSNDLFESGSAELVAHIFPVVSKVARALEATNGKILVVGHTD
NNPIFTSKFPSNWHLSLARATALTDRLASAGKLSGRVIPEGMGDARPLVSNETVEGRSIN
RRVEIDLLVQTQSKMDANNGKD
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggacgaaacgattgtaaaaccaacccctgggcgtaaaaaagcaccgcagtcgacacct
gttgcatcgcttgaaagcgataacacggttctctttacgcaaaatagtaaagaaacgcgt
gaaacgagtatcgtcgcgtttggcaataacgtactgctggcagaagcgaatgtcattgtt
tccttgcttggccaaattagagcgacggccacgcacagtgatgtcaaacagttacgtgaa
gcatttgtgcaaaaaatgcgtgactatgaaaaccggttgagattacaaggcgcaaatagt
aagcagatcgatatcgcacgctactgtttatgttgtgctatcgatgaagccgtcctaaat
accgaatggggaagtcaatccgtttggggacacaactcgttattgtcgacattctattcc
aatactcaaggcggtgagcagttcttcatacatctcgatgaaagccttgccgaacccaat
aagcacttagatctgctagaagtcatgtatatctgcatgagcttaggttttttggggcaa
tttcgagttcgagaaaatggaatcgagcaacatcgttccttaaaaaaccgcgtaatggat
gtccttaaatcgcacggtcgggactacagtccttcactcaacgatggtgcgttagccaaa
gtattggttggtgagcagatcgcagaaaaagcaccattgtgggttgttttatcaattacc
gcagctgtgttagccagtgtgtacatgtacttaagttatagcctaaacgaaaaatccgat
cagacctttagtcagttaatgaacttagtgccgagcaaagagatagagaaccagagtgcg
gattatatttcatctcttgccgtagcaaatcaaatccaacgttcgttggcaacggaaata
gaaatgggtttactaaaagtcgatgcattacccgatagagtgcgtattacttttcagtcc
aatgatctgtttgaatcgggcagtgcggagcttgtcgcgcatatattccctgtggtttcg
aaagtggccagagcactcgaggcgaccaatggaaaaatattggttgtcgggcataccgat
aataaccccatttttaccagtaaattcccttctaactggcatttatctctcgccagagcg
acagcgcttaccgatcgcttagcatcagcaggcaaattgagtgggcgtgtcattcctgaa
ggaatgggagatgcgagacctttggtatcaaatgaaaccgtagaaggaagaagcatcaac
cgtagagtcgaaatcgatctcctagttcaaacccaatcaaaaatggatgcaaacaatggc
aaagattaa

DBGET integrated database retrieval system