KEGG   Vibrio vulnificus YJ016: VVA1210Help
Entry
VVA1210           CDS       T00150                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00071  Fatty acid degradation
vvy00072  Synthesis and degradation of ketone bodies
vvy00280  Valine, leucine and isoleucine degradation
vvy00310  Lysine degradation
vvy00362  Benzoate degradation
vvy00380  Tryptophan metabolism
vvy00620  Pyruvate metabolism
vvy00630  Glyoxylate and dicarboxylate metabolism
vvy00640  Propanoate metabolism
vvy00650  Butanoate metabolism
vvy00900  Terpenoid backbone biosynthesis
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
vvy01200  Carbon metabolism
vvy01212  Fatty acid metabolism
vvy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VVA1210
   00630 Glyoxylate and dicarboxylate metabolism
    VVA1210
   00640 Propanoate metabolism
    VVA1210
   00650 Butanoate metabolism
    VVA1210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VVA1210
   00072 Synthesis and degradation of ketone bodies
    VVA1210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VVA1210
   00310 Lysine degradation
    VVA1210
   00380 Tryptophan metabolism
    VVA1210
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VVA1210
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VVA1210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VVA1210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvy04147]
    VVA1210
Enzymes [BR:vvy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VVA1210
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VVA1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAC97236
UniProt: Q7MD26
Position
II:complement(1330840..1332048)
Genome map
AA seq 402 aa AA seqDB search
MEKVFIVAAKRTPIGAFGGSLKTVAAGELASVAIKGAIEQAKVDASLIDEVIVGNVVSAA
QGMGIGRQAAILAGIPAEVPAYTLNMVCGSGMKTVMDGVSHIRSGDAKVVVAAGVEVMSQ
IPFTVPANVRDGNKMGHMALQDLLIADGLTDVFNQYHMGVTAENVAKEVGITRDQQDEYA
LASQQKAVAAIEAGKFKDEIVPVEVTVRRQTVTFDTDEYPKANATLEALKGLRPAFDKEG
TVTAGNASGINDGASAVILASEQAVKEYGLQPIAEVVSYAQSGLDPKIMGLGPVEAVSKA
LEKAQLNTADIDVYELNEAFAAQALGVIHQLADKHQVPVASIQDKANPNGGAIALGHPLG
ASGNRILVTLIHELQKQNGQYGVASLCVGGGMGTAVIVKAVK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtatttattgttgcggccaaacgtaccccgattggcgcttttggcggctcg
ttgaaaacggtagccgctggagaattggcatctgttgccatcaaaggtgcaattgaacaa
gccaaagtggatgcttcactgattgatgaagtgatcgtgggtaatgtggtgagtgctgcg
caaggtatgggcattggccgtcaagccgcaatcctagccggtatcccagcagaagttccg
gcttacaccctcaatatggtgtgtggcagtggcatgaaaaccgtcatggatggcgtttct
catattcgcagtggcgacgcaaaagtggtggttgctgctggtgtcgaagtgatgtcacaa
atcccatttacagtacctgcaaacgttcgtgatggtaacaagatgggccatatggcactg
caagatttgctgattgctgatggtttgactgatgttttcaatcaataccatatgggcgtt
acagcagaaaatgtcgcgaaagaagtgggcattactcgtgatcagcaagatgaatatgca
ttggcgagtcaacagaaagcggtagcggcgatagaagctggcaaatttaaagacgaaatt
gtgcccgttgaagtgaccgtgcgtcgccaaacagtgacgtttgataccgatgaatatcca
aaagccaacgcaacgcttgaagcgctaaaagggttacgtcctgcctttgataaagaaggc
acggtcaccgcgggcaatgcttctggcattaatgatggggcgagtgccgtcattctggca
tccgagcaagcagtgaaagaatacggtttgcaacctatcgcagaagtggtgagttacgca
cagtctggccttgacccaaaaatcatgggcttaggccctgttgaggcggttagcaaagcg
cttgaaaaagcacaactgaatacagcagacattgatgtgtatgagttgaatgaagccttt
gccgcacaagccctaggcgtgattcatcagcttgccgataaacaccaagtgccagtggca
tcgattcaagacaaagcgaacccgaatggtggtgccatcgcattagggcatccgctaggt
gcgtcgggtaaccgaattctcgtgacgttaattcatgagcttcaaaaacaaaacggtcag
tatggcgttgcgtcactatgtgttggtggcggtatgggaacggcagtgattgtgaaagca
gttaagtaa

DBGET integrated database retrieval system