KEGG   Vibrio vulnificus YJ016: VVP15
Entry
VVP15             CDS       T00150                                 

Definition
(GenBank) putative conjugative transfer protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVP15
Secretion system [BR:vvy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VVP15
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: BAC97738
UniProt: Q7MBM8
Position
pYJ016:11320..13053
AA seq 577 aa
MFPMRLYFWTALALSLFCTLAFADDQQTFTDSANWAKQTASQALTPNALPLNIDEYCADA
TCRRDIRAPKEANLSDSDINAQKGAAFASDEVAQSINANFNQGRPDIKNDPAMQFALLGQ
ENAFEVTHGLSNAYVDCQKGTQCTIEHRPRQCNQPTNNAVPCDKIPVFKPETTPVSYQCK
SGWTLNGTLCKKPSVECRYDYYNKVLEHGGNCGGGDYSYAWWERQRPNFPYWKGKKTYDR
EYNCRGGEHSGWEKNWEICRAIELSEPATPTCSSGYTLAGHTCVKQVPSWQSQCSLINSC
KAISETCIDGPQTRLINGIPTYLDCWKYRTTYHCELSDSCATLPKDCQEQSRTCSLKQNG
VCVEDEVKKACPHKQCSTTQLSCGEQSFCLDGDCYTEEPKLNGNFDKSVAALAGLSEAVK
DIGDPPQIFTGKPMKCDKKLAGFNDCCKDSGWGQNLGAKCSEAEEALGKAKEKGLTLYVG
EYCASKVLGVCTRKKRSYCVYDSKLAKIIQEQGSIGQLGKGLGSAKSPTCAAITPEELGQ
INFEYIDFKEFYPEMHANTQLPNFDEIKKRLQSATGN
NT seq 1734 nt   +upstreamnt  +downstreamnt
gtgtttcctatgcgcctgtatttttggactgcgctcgcgctcagcctgttttgcactttg
gcgttcgccgacgaccaacaaacttttaccgacagcgccaattgggcaaagcaaaccgcg
agtcaagcgctcacacccaacgcgctaccgctcaatatcgatgagtattgtgccgatgct
acctgccgtcgagatatccgcgcgcctaaagaagcaaacctatctgacagtgacatcaat
gcccaaaaaggcgcggcttttgccagcgatgaggtagcgcaaagcatcaacgccaatttc
aaccaaggccgacccgacatcaaaaacgatccagccatgcaatttgctttgctcggtcaa
gaaaacgcctttgaagtcacacacggcctctccaacgcttatgtcgattgccaaaaggga
acacaatgtaccattgagcaccgaccaaggcagtgtaatcagccgacgaataatgccgtt
ccttgtgacaagatcccggtatttaaacccgagacgacccccgtgtcctaccaatgcaaa
tcaggatggacgctcaacggcacattatgcaaaaaaccgtccgtcgagtgccgttacgac
tattacaacaaagtgcttgagcatggcgggaactgcgggggtggcgactattcttacgct
tggtgggaaaggcaacgcccaaactttccgtattggaaaggcaaaaagacttacgaccgc
gaatacaattgtcgaggtggggaacatagcggatgggagaaaaattgggaaatctgccga
gccatcgagctctcagagcccgccaccccgacctgctcatctggatacaccctagcgggg
catacttgcgtcaaacaagttccctcttggcagagccagtgctcactcattaactcatgc
aaagccatctcagaaacctgcattgatgggccacaaacccgccttattaacggcattccc
acttatcttgattgctggaaataccgcaccacttaccattgtgagctctcagattcatgc
gccaccctacccaaagactgccaagagcaatctcgcacctgctcactcaaacaaaacggg
gtttgtgtggaagatgaagttaaaaaagcctgtccacacaagcaatgcagcaccacccaa
cttagctgtggcgaacaatctttttgtcttgatggcgattgttatacagaggagcccaaa
ctcaatggcaactttgataaatcggtcgcggcgttagcggggctttccgaagcggtcaaa
gacattggcgacccgccacaaatctttacgggtaaacccatgaagtgcgacaaaaaactc
gccggctttaacgactgttgcaaagactcgggctggggacaaaaccttggcgctaaatgc
agcgaagccgaagaggcactaggcaaggccaaagagaaaggattaaccctctatgtcggg
gaatattgcgccagcaaagtcttaggcgtttgcactcgtaaaaagcgcagctactgcgtc
tatgacagcaagcttgccaaaatcattcaagagcaagggtctatcggacaattaggcaag
gggcttggcagtgcaaaaagccctacctgcgccgcgataacccccgaagaattgggacaa
atcaactttgagtacatcgactttaaagagttttacccagagatgcacgccaacacccaa
ctcccaaactttgatgaaatcaagaagcgacttcaaagcgcaacgggcaattaa

DBGET integrated database retrieval system