KEGG   Candidatus Woesebacteria bacterium GW2011_GWF1_31_35: UR17_C0001G0254Help
Entry
UR17_C0001G0254   CDS       T04464                                 

Definition
(GenBank) UDP-glucuronate decarboxylase, dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
wba  Candidatus Woesebacteria bacterium GW2011_GWF1_31_35
Pathway
wba00520  Amino sugar and nucleotide sugar metabolism
wba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UR17_C0001G0254
Enzymes [BR:wba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     UR17_C0001G0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: AKM83062
Position
complement(228618..229562)
Genome map
AA seq 314 aa AA seqDB search
MEKILVTGGVGFIGSHLCNSLLSDGFAVVCLDNLITGNRGNIKSLLTNPNFEFIEADVIK
PLTFDYLNLKYIFHLASPASPIDYQNNSEETLLANSLGTLNILNIAKEIKAKVLIASTSE
IYGDPLEHPQKEIYWGNANSFGPRSCYDESKRFAEAATYVFLNKYGIDARIIRIFNTYGP
NMRKDDGRVISNFINWAINGLPIKIDGDGSQTRSFCYITDLVSGIKKAMFTDGTRGEIFN
LGNPDEFKIGDLSNKIIELTDSKSEVIFSNSFRPDDPMQRCPDITKAKGILKWEPKVDLI
DGLQKTIEYYKDLK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcttggtaacaggtggggtggggtttattggaagccatctttgtaatagt
ttactcagtgatggttttgcagtagtttgccttgacaacttaattactggaaatagggga
aacattaaaagtctattaactaatccaaactttgaatttattgaggctgatgttatcaaa
cctttaacatttgattatttaaacttaaaatatatttttcatttagcttctccagcttca
cctattgattatcaaaacaattctgaagaaacacttttagctaattctttggggacttta
aatatattaaatatagcaaaagaaattaaagctaaagtattaattgcttcaacatcagaa
atctatggtgatccacttgaacatcctcaaaaagaaatctattggggaaatgcaaattca
tttggaccaagaagttgttatgatgagagcaaaaggtttgcagaagctgcaacttatgta
tttttaaataaatatggaattgatgcaagaataattagaatttttaatacatatggacca
aatatgagaaaagatgatgggagagtaattagcaattttattaactgggcaattaatgga
ttaccaataaaaattgatggtgacggaagccaaacaaggtcgttttgttatattacggat
ttggttagcgggattaagaaggcgatgtttacggatggaactaggggagaaatatttaat
ttaggtaatccagatgaatttaagattggtgacctttctaataaaattattgaacttact
gattcaaaatctgaagtaattttctcaaattcatttagacccgatgacccaatgcaaaga
tgtcctgatattacaaaagcaaaaggtattttaaaatgggaaccaaaagttgatttaatt
gatgggcttcaaaagactattgagtattataaagatttgaaataa

DBGET integrated database retrieval system