KEGG   Wolbachia wBm (Brugia malayi): Wbm0108Help
Entry
Wbm0108           CDS       T00234                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00020  Citrate cycle (TCA cycle)
wbm00310  Lysine degradation
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01120  Microbial metabolism in diverse environments
wbm01130  Biosynthesis of antibiotics
wbm01200  Carbon metabolism
Module
wbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Wbm0108
  Amino acid metabolism
   00310 Lysine degradation
    Wbm0108
Enzymes [BR:wbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Wbm0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAW70700
UniProt: Q5GTH4
Position
complement(140462..141622)
Genome map
AA seq 386 aa AA seqDB search
MNKIIEIRAPKTLGGESITEGVIKIKKSIGEAIEVDDLIFEIETDKTALELTAEASGQIT
EFLVSEGDVISPDQLLAKLSVGEVKKEDKSENLAKRDAPSARKIMEENAISTESVKGTGM
GSRITKADVIDHMRKAEQPTIKQYELPKSAASGERREERVKMSKIRQVIAARLKASQNTA
AILTTFNEIDMKNVIDLRAKYKETFEKKYGIKLGFMSFFIKAAVQALREIPEINAEISGD
EIIYKRYYDIGVAVGTNKGLVVPAIRNADQMSFAEIELTLADLGKKAREGKLQVSEMEDA
TFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRPFAVGNSIEIRPMMYIALSYDHRII
DGKGAVTFLVKIKNYIEDPNRLVLEV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattatagaaattagagcaccaaagactcttggtggtgaatcgatcacagaa
ggtgtaatcaaaataaagaaaagtattggcgaagcaatagaagtagatgacttaatcttt
gaaattgaaactgataaaacagcactcgaactaactgcagaagcttcaggacaaataact
gaatttcttgtaagtgaaggcgatgtgataagccctgatcaattgttggcaaaactttcc
gtaggagaggtgaagaaagaagataaaagtgagaaccttgctaaaagagacgctccatca
gctcgtaaaattatggaggaaaatgcaatcagtacagaaagtgttaaagggactggtatg
ggaagcaggataaccaaagcagacgtgatagatcatatgagaaaagctgaacaacctact
ataaaacaatatgaattgccaaaaagtgcagcaagtggggaacggagagaagagcgagta
aaaatgagcaaaataaggcaagtaattgctgctcgtttaaaagcttcacaaaatacagct
gcgatactgaccacatttaatgaaattgacatgaaaaatgttatagatctcagggcaaaa
tataaagaaacctttgaaaagaaatatggaataaagcttggcttcatgtcgttctttata
aaggcagcggtgcaagcactgagagaaattcctgaaattaacgctgaaatttcaggtgat
gaaatcatatacaaacgttactatgacataggtgttgccgttggcactaacaaaggtctt
gttgtgccagctattcgaaatgctgatcagatgtcatttgctgaaattgagctaactttg
gctgatctcggtaaaaaagcacgagaaggtaagctacaagtatcagaaatggaagatgca
acatttactatttcaaacggtggagtatacggttcgctcctttccactccgataataaac
cctccacaatctggaatacttggaatgcattcaatacaaaataggccatttgctgtgggc
aactcaattgaaattagacctatgatgtacattgccctctcctacgaccatagaataatt
gacggcaaaggagcagtaacttttctcgtcaaaataaaaaattatatagaagatccaaac
aggttagttttggaggtatag

DBGET integrated database retrieval system