KEGG   Wolbachia wBm (Brugia malayi): Wbm0146Help
Entry
Wbm0146           CDS       T00234                                 

Definition
(GenBank) Kef-type K+ transport system, membrane component
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
wbm  Wolbachia wBm (Brugia malayi)
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Wbm0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N UDPG_MGDP_dh_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AAW70737
UniProt: Q5GTD7
Position
complement(185400..187118)
Genome map
AA seq 572 aa AA seqDB search
MHSGSQHLFDIIILLSAAVFIVIAFWKMNISPVLGYFVAGALIGSHGFNLIHSAKAMDNF
AEFGVVFLLFIIGLELTFERLIAMRIHVFGFGSLQVIVTMVAIWCIALAFGVNTNMAAVI
GGGLALSSTAIVLQVLQEKGSQASQVGRLSIAVLLMQDFAVVPLIVLVPLLTGNSENSLI
SSLTGSLLQAAIALVMIFITGRLLLRPLFSIIARMESNEVFISTTLLIILGAAFITEQFR
LSMALGAFVAGLLVAETEHRHSVEHAVLPFKDLLLGLFFMTVGMSINIDLLLNKLPLITL
LSIILIVLKTSIIYMLCRFFGFKRAPAIQAGLLLAQGGEFAFILFRLADELNVLPSEIAQ
VLMMVTTVTMAFTPLLSGLGDWIVNSFSTEKVILDDEAVETDTQDLYNHVIVAGFGRVGY
MVTKMLTAEHLSYVVVDIQSKIVKEGKSDSFPIYLGDATRYEILKSVGIGRAQALVISIK
NEVTIKKIVSLVATNFPHVNIIIRLPDLSNAEVYKDLGASKIIPETSEMGLQLGGAALSL
SGISESGVASLKSKFRKGNYSMIKDISSDMDE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcggttctcagcatttgtttgatattataattttactctccgctgctgtcttt
atagtcatagcattttggaaaatgaatatcagcccagtgcttggttactttgttgcaggc
gcattgattggatctcatggttttaatctaatacattcagccaaggcaatggataacttt
gcagaattcggcgtagtgtttctgttgttcattataggtcttgaattgacgtttgaacgc
cttattgccatgcgcattcatgtatttgggttcggttcccttcaagttatagtcactatg
gtagcaatatggtgcattgctcttgcttttggagtgaatacaaacatggcagcagttatt
ggtggcggacttgcattatcctcaacagcaatagtattacaggttctgcaggaaaaaggt
tctcaagcaagtcaagttggtaggttatcaatagcagtgctattaatgcaagattttgca
gtggtaccgttaatagtattagtgcctctacttactggtaactctgaaaatagtctgata
agttcattaacaggttcattattacaagcagctattgcattagtaatgatatttataact
ggtaggttattacttaggcctttattttcgattattgctagaatggaaagtaatgaggtc
tttatatcaactacgcttttaataatattaggggcagcatttattactgagcaatttcgt
ttatcgatggcgttaggggcatttgttgctggattattagttgcggaaacagagcatagg
cactcagtagaacatgcagtattgccgtttaaagatttgctactcggcttatttttcatg
actgttggcatgtctatcaatatagatcttttgctcaataagttgccactaattactttg
ttgtcgattatcctgatagttttaaaaacatctatcatatatatgttgtgtagattcttt
gggtttaagcgtgcccctgctatacaagctgggttgctgcttgcacaaggcggtgagttt
gcatttattctatttcgtttagcagatgaattaaatgtgttaccaagcgaaatcgctcaa
gtgcttatgatggtgactacggtaactatggctttcactcctcttttgtcaggacttgga
gactggatagtaaattcatttagcactgaaaaagtaatactagatgatgaagctgttgag
acagatacacaagatctttataaccatgtaatagttgctgggtttggtagggtaggatat
atggtaacaaaaatgcttactgcggagcatttaagttacgttgttgtggatattcaatca
aaaatagttaaggaaggaaagagtgacagctttcctatatatcttggagatgctacaaga
tatgaaattttaaaatcagtaggaataggaagagcccaggctcttgtgatctcaataaag
aacgaagttactataaagaagattgtttctttggttgcaacaaattttccacatgtaaat
attataatacgtttaccggatctaagtaatgcagaggtgtataaagatctgggagctagc
aagattattcctgagacatccgagatggggttgcaattaggtggagcagcattgagctta
agtggaattagtgaaagtggagttgcatctttaaagagtaagtttaggaaaggtaattat
agtatgataaaggacattagcagtgatatggatgaatga

DBGET integrated database retrieval system