KEGG   Wolbachia wBm (Brugia malayi): Wbm0580Help
Entry
Wbm0580           CDS       T00234                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00230  Purine metabolism
wbm01100  Metabolic pathways
Module
wbm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:wbm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Wbm0580
Enzymes [BR:wbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Wbm0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 MMR_HSR1 RsgA_GTPase cobW AAA_16 AAA_22 AAA_28 Thymidylate_kin MobB Dynamin_N AAA_30
Motif
Other DBs
NCBI-ProteinID: AAW71168
UniProt: Q5GS56
Position
complement(756340..756927)
Genome map
AA seq 195 aa AA seqDB search
MAVENEGVLLVLSSPSGAGKTTILERLLERSTNLVRSVSMTTRKPRPGEINGKDYFFVTK
KEFHELCEAGQMLEYARVFENFYGIPKSFIEQNLSSGISVLLSIDWQGAFHLFELMREKV
ISVFILPPSMEELRLRLQKRNSDSASEIEHRLAEAQKEMSKRDKYDYVVINDDIDKSVEE
ISSILDKERLKRSGV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagagaatgaaggtgtattattagttttatcttctccttctggagctggcaaa
actactatattagagagattacttgagcgatcgactaatttagttagatcggtttctatg
actacacgcaaacctcgcccaggcgaaataaatggaaaagactatttttttgttaccaag
aaagaatttcatgagttatgtgaagctggtcaaatgcttgagtacgccagagtttttgaa
aatttttatggcataccgaaaagttttatagaacagaacctgagcagtggaataagcgtt
ttactaagtatagattggcaaggagcatttcatttatttgagcttatgagggaaaaagtt
ataagtgtttttatacttcccccttcaatggaggagcttaggttgcgtttgcaaaaacgt
aatagtgacagtgcaagtgaaatagaacacaggttagccgaagctcaaaaagagatgagc
aagcgcgataaatatgattatgtagtaatcaatgatgatattgataagagtgtagaagag
ataagttctatattagataaagaaagacttaaaagatcaggggtttag

DBGET integrated database retrieval system