KEGG   Wolbachia wBm (Brugia malayi): Wbm0704Help
Entry
Wbm0704           CDS       T00234                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00970  Aminoacyl-tRNA biosynthesis
wbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Wbm0704
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wbm03029]
    Wbm0704
Enzymes [BR:wbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Wbm0704
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Wbm0704
Mitochondrial biogenesis [BR:wbm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Wbm0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AAW71292
UniProt: Q5GRT2
Position
complement(914478..915902)
Genome map
AA seq 474 aa AA seqDB search
MTKGDWEAVIGLEVHAQVSSKTKLFSSSSTEFGAEHNTQVSLVDAAMPGTLPILNYYSIE
QAIRTGLALSAEINKSSYFDRKNYFYPDLPQGYQITQFFEPIVKNGRIFINNNKKEVRIA
RIHLEQDAGKSIHEESKTYVDLNRAGVALMEIVSEPDLRSSEEAAEFMKKLRQILRYIGS
CDGDMEKGSLRCDANVSVRPKGSSTFGTRCEIKNLNSICYIMQAIDYEIQRQIEILESGE
KISQDTLLFDVSLGKTKVMRNKEDASDYRYFPEPDLLPVEISQDKIDSIRSSLPELPDQK
KLRYIRELSINKYDADVITSDKAIANYFEELIKKHDSKLAVTWLTVELFGRLNKAGIDIV
SSPIKANALSELLDFIVDGTISARLGKQVFDIMFETGKPASLIIKEQDLKQITDKGQISE
IIDKIINDNQDKVQEYQNGKTKLYGFFVGEVMKLTKGKASPDVVNFILSEKLSS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggggattgggaagcggtaattgggcttgaggtgcacgctcaagtttcttct
aagacaaagctattttctagctcatcaactgagtttggcgctgaacataacactcaagtt
tctctggttgatgcagcaatgccaggtacactaccaatactgaactactactctatagag
caggcaatacgcactggtcttgcactttctgcggaaattaataagagctcttactttgat
cggaaaaattatttttaccctgatttaccgcaaggttatcaaataactcagttttttgag
ccaatagttaaaaatggtagaatatttatcaataataataaaaaagaagtaagaatcgca
agaattcatctagagcaagatgcaggaaaaagcattcatgaagagagcaaaacttatgta
gatttaaatcgtgcaggggttgctctaatggaaattgtctcggagccggatcttcgttca
tctgaggaagctgcggaattcatgaaaaagttgaggcagattttgcgttacattggctca
tgtgatggtgatatggaaaaggggtcgcttcgttgtgatgcaaatgtttctgttcgccca
aaaggcagtagcacattcggcacccgctgcgagataaaaaacctaaactcaatatgttat
attatgcaagctatagattatgaaatacaaaggcaaattgaaattttggaaagtggcgag
aaaataagtcaagataccttgttgtttgatgtttctttaggaaaaacaaaagtaatgcga
aacaaagaggatgcgagtgattataggtattttcctgaacctgatttactgcctgttgag
ataagccaggataaaattgattctattagatcatctttgcccgaattgccagatcaaaaa
aagctacgatacattagagaattaagtatcaacaaatacgatgctgatgtcatcacttct
gataaagcaattgctaactattttgaggagttgataaaaaagcacgattcaaaacttgct
gttacttggctaactgtagagcttttcggtcgtttgaataaagcgggtattgatattgtg
agctccccaattaaagcaaatgccttatccgaactcttagattttatcgttgatggaacg
atctctgctaggcttggcaagcaagtttttgatattatgtttgaaactggcaagccagca
tctttgatcataaaagagcaggacctgaagcaaataaccgataaaggtcaaatatcagaa
attattgacaaaatcatcaatgacaaccaagataaggttcaagaataccaaaatggtaaa
acaaaactatacggattctttgttggcgaagtcatgaaacttaccaaaggaaaagctagc
cctgatgtcgtgaactttattttgagtgaaaaattgagcagttag

DBGET integrated database retrieval system