KEGG   Wolbachia wBm (Brugia malayi): Wbm0747Help
Entry
Wbm0747           CDS       T00234                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00010  Glycolysis / Gluconeogenesis
wbm00020  Citrate cycle (TCA cycle)
wbm00620  Pyruvate metabolism
wbm01100  Metabolic pathways
wbm01110  Biosynthesis of secondary metabolites
wbm01120  Microbial metabolism in diverse environments
wbm01130  Biosynthesis of antibiotics
wbm01200  Carbon metabolism
Module
wbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Wbm0747
   00020 Citrate cycle (TCA cycle)
    Wbm0747
   00620 Pyruvate metabolism
    Wbm0747
Enzymes [BR:wbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Wbm0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAW71335
UniProt: Q5GRN9
Position
complement(981613..982884)
Genome map
AA seq 423 aa AA seqDB search
MPIEILMPALSPTMSKTGGKIVKWCKKEQDRVEVGDVIAEIETDKAIMEFESVDRGVLAK
ILVSEGTSGVPVNQLIALMLEEGEDKSAIDNYVSVPAVNIEVKEKVVTTSSVSSNPSMSS
QCLTQESKKEEGTKTTESRIKVSPLAKKIAQNEGINVRRLKGTGPYGRIIKADVLGFLDS
GVQIKNRERSDEDTILEVSNMRQVIAQRLIEAKQNIPHFYLTVECQVDKLISLKNEINSA
DKNNKVTINDLIIKAVAFSMKKFPDINSSWIDNKILRYANIDISIAVALEDGLITPIVKN
ADEKGILSISKEVKDLVIRARSGKLGPEEFQGGGFTISNLGMFSIKTFSAIINPPQSCIM
AIGTSKKQPIVIDEKIEIVEIITVTLSVDHRAVDGVLGAKFLNAFKHYIENPLAMLIEAR
VNI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaaatattaatgcctgctctttctccaacgatgagtaaaactgggggaaag
attgtgaagtggtgtaagaaagagcaagatagagttgaagtaggtgatgtaattgctgaa
atagagactgataaagccataatggagtttgaatctgtagatagaggggttttagcgaaa
attttagtgtcggaaggaacaagcggcgtgcctgttaatcagctgatagctctaatgcta
gaagaaggggaagacaaaagtgcgattgataactatgtttcagttcctgctgtcaatatt
gaggttaaggagaaagttgtaaccacctcttcagtatcatccaacccttcgatgtcatct
cagtgcttgacacaggaatctaagaaggaagagggtactaagacaacagaaagtaggata
aaagtaagcccattagctaaaaaaatagctcagaatgaagggatcaatgttagacggtta
aagggtactgggccatatggccgtattattaaagctgatgtactggggtttttagatagt
ggtgtacaaattaaaaatcgtgaaagatcggatgaagatactatacttgaagtaagtaac
atgcgccaagtgatagcgcaacgcctcattgaggctaaacagaatattccacatttttac
ttaactgtggagtgccaagttgataagctaatatcgctcaaaaatgagattaactcagca
gataaaaacaataaagtaacaattaatgacttaattataaaagctgtggctttcagcatg
aaaaaatttcctgatataaattcttcgtggatagataataaaatactgaggtatgcaaat
atagatatttcaatcgctgtagcacttgaagatggactcattactcctatagtgaaaaat
gctgatgaaaaaggtattttgtctatatcaaaagaagtgaaagatctagtaatcagagcg
aggtctggaaaattgggaccagaagaatttcaaggaggcggatttactatctccaactta
ggaatgttcagtataaaaacttttagtgctataatcaatccaccacagtcttgcattatg
gctattggtacatctaaaaagcagcctattgttatcgatgaaaaaatagagatagtagag
ataataacagtaacgctttctgttgaccacagagcagttgacggggtgttaggagcaaaa
tttttaaacgcctttaaacattatatagagaatcctctggcaatgcttattgaagctaga
gtaaatatttag

DBGET integrated database retrieval system