KEGG   Wolbachia wBm (Brugia malayi): Wbm0763Help
Entry
Wbm0763           CDS       T00234                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
wbm  Wolbachia wBm (Brugia malayi)
Pathway
wbm00970  Aminoacyl-tRNA biosynthesis
wbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wbm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Wbm0763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wbm03029]
    Wbm0763
Enzymes [BR:wbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Wbm0763
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Wbm0763
Mitochondrial biogenesis [BR:wbm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Wbm0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AAW71351
UniProt: Q5GRM3
Position
complement(1000701..1002137)
Genome map
AA seq 478 aa AA seqDB search
MHNGLKQRSFSAVELIEVHINAVENEKLNAFITKTPEIAIKAAKTADERFSQQKDSTISP
LMGIPVGVKDLFCTKGVKTTACSKMLENFIPTYESTVSDLLLKSGAAMLGKLNMDEFAMG
SANINSYFGPVENVWVRKSDGEKVVPGGSSGGSAASVAGFLCAGALGSDTGGSVRQPAAY
CGVVGAKPTYGRCSRFGMIAFASSLDQAGVITRSVSDSALMLETICGYDNKDSTSSERPV
PRFSNFINGDIKGRRIGIPKEYRMDGISEEIIYHWEKVSSDLKENGAEVVDITLPHTKYA
IPVYYLICSAEASSNLARYDGVRYGLRVNADILEEMYSLTRAEGFGKEVKRRILIGAYAL
SSGHYNEYYEKAQCIRALIRNDFIKAFEKIDYILVPSAPTEAFGLNEKPDPLIMCINDVF
TVPASLAGLPAISVPVGLSNEGLPLALQVIGNYYDEAGMLNVASVIEQNCSRIIKLNS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcataatggacttaaacagagaagtttttctgctgttgaacttattgaagtgcatatc
aatgcagtagaaaatgagaaactaaatgcattcataacgaaaactccggaaatagcaata
aaagctgcaaaaactgcggatgagcgtttttcccaacaaaaggatagtacgatctcaccg
ctcatgggtataccagttggtgttaaagatttgttctgtacgaaaggagtaaaaacgaca
gcatgttcaaaaatgctagaaaatttcattccaacttacgaatctacggtatctgactta
cttttaaaaagtggagcagccatgctgggtaaacttaacatggatgaatttgctatgggc
tctgcaaacataaatagctattttggtcctgttgaaaatgtatgggttagaaaaagtgat
ggggaaaaggttgtacctggtggatcatctggtggatctgcagcatcagtcgctggattc
ttatgtgctggagcactcggaagtgatactggtggatctgtgcgtcaaccagcagcttat
tgtggtgtagttggagcaaaaccaacttatggaagatgctcgcgttttggcatgatcgca
tttgcaagttctttagaccaagcaggggtcattactcgttctgtttctgattcagcacta
atgttggaaacgatttgtggttatgataacaaagattcaacatctagtgaaagaccagta
cctagattttctaattttataaatggtgatatcaaaggtaggcgcattggtataccaaaa
gaatatagaatggatggaatttcagaagaaatcatctatcattgggaaaaagtttcttct
gatttaaaagaaaatggtgctgaagttgttgatattaccttacctcatactaaatatgca
ataccagtctattatttaatttgttctgctgaagcttcgtctaatcttgctcgttatgat
ggtgtgcgctatggactcagggttaatgctgatatccttgaagaaatgtattcactaacg
agagcggaaggttttggaaaagaggtaaaaagaagaatcttaattggcgcttacgcactc
tcttctggtcactacaatgaatactatgaaaaagcgcaatgtattagggcgttaattaga
aatgattttataaaagcgtttgaaaaaatagattatatacttgttccatctgctccaaca
gaagcttttggcttgaatgaaaagccagacccactaattatgtgcattaatgatgtcttt
actgtgccggcaagtttagctggtctacctgctatctctgttcctgttggactttccaat
gagggtttaccgcttgctttacaagtaatcggaaactattatgatgaagctggaatgtta
aatgtagcaagtgtaatagagcaaaattgcagtaggataatcaagttgaatagctag

DBGET integrated database retrieval system