KEGG   Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis): recCHelp
Entry
recC              CDS       T00101                                 

Definition
(GenBank) DNA metabolism
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
wbr  Wigglesworthia glossinidia brevipalpis (Glossina brevipalpis)
Pathway
wbr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:wbr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    recC
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:wbr03400]
    recC
Enzymes [BR:wbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     recC
DNA repair and recombination proteins [BR:wbr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     recC
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C Rep_fac-A_3
Motif
Other DBs
NCBI-ProteinID: BAC24411
UniProt: Q8D2T9
Position
308131..311382
Genome map
AA seq 1083 aa AA seqDB search
MIYIYQSNQIDLIQKILSKILKNFPINNPMKKEIIITSSSNISEWLKLNITLNINILANV
EFISLNSFIWKLVILTTKNVPFDNFAFRLMLSWYIAQIIPKINKNIKIKNVYKNLNQFQI
FYLSYKLSELYNKYLIFKPDWIDLLNFKKKSKKLEDSQYFQLIIWNLLVKKIKKEKDFCI
SSIYESCIQKIEKSNLIFEDIADRIFIFGIYYIPEIYLKILKTLSKKIDIHLFCINPCCL
YWFDIDNRFYISNLIENKIKNKKNFFRKKIKISLLSFWGCLGAKYLKLLNNLNENIENKI
FYKPKKDNLLHTIQNDILYNKYYNIIISKKFNKFEKKNLRVLNSKDNSITIHTCKNKYEE
INSLYNFIVKITKDNKKICFKDILVMASNIEDYSSYINSIFNNINYKINYFISDIKIYER
FNIISAIFNILKLPKFKFSIEQIFYLLEFSSISNKFKMKEDEIKMLKYLVINLGVQWGIS
NKRFKKCNANFEEKYSWNNIIKKTVSEYYTRINNKVYFKYIYSNDLDEKKINSLIKLENF
ISKLNYWYDYLSQPHLLYEWNDVIKKIIKNFFDPDKKENYVLDLLKKNWNDIIFQGINTK
YKKTIYIETLENILYKRFKKENFFKKNKFNSIHFCNLKLSKIIPSKIICLLGINDGTYPR
QDINYNFDSIYKNLKNDDKNIRQEDLYSFLIILLSSKEHLYISFIKNYINEERSKYISII
INELIEYISVSFYIKNCKSYNFLENINNIKKILFKKYNNFYFFRKEKIEIFNKKYFLNNI
NINSDKKIFSKISINEFFLFYSNPIKFWCKKKLKINFSKEHLYKDNEFILKNKFNSYRIN
IILFEYLIKNKYLNKKDLLKNTIKYFFDGVFEEIIIEKKYYQIIKLINNINKHLLMKKET
KKVFFKLDRTIIFGWLPNLQNSGLLRWNPKNLSLQDGFLFWIEHLIYCIIGGKGDSIFLG
IESYWHFKNINYKKAKHFFKKLLVGYELGIENPIFLLNKSGGAWINHSFNKEKNKLILDE
KTKKNARSKLISAWQGNKFINGDSQDFYISKVIPFLTENNINKIINESKKYFIFPLKFNK
LLK
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatatatcaatctaatcaaattgatcttatacaaaaaatattatcaaaaata
ttaaagaatttccctataaataaccctatgaaaaaagaaataataattactagtagttca
aatatttctgaatggttaaaattaaatattactttaaatataaatattttagctaatgta
gaatttatatctcttaatagttttatttggaaattagttatattaacaacaaaaaatgtt
ccatttgataattttgcatttagattaatgctttcttggtatattgctcaaataattcca
aaaataaataaaaatattaaaataaaaaacgtttataaaaatttaaatcaatttcaaata
ttttatttatcatataaattatctgaattatataataaatatttaatattcaaacctgat
tggattgatttattaaattttaaaaaaaaatctaaaaaattagaggattctcaatatttt
caactaattatatggaatttattagtaaaaaaaataaaaaaagaaaaagatttttgtatt
tctagcatatatgaatcgtgtatacaaaaaatagaaaaatcaaatcttatttttgaagat
attgctgatagaatttttatatttggaatatattatattcctgaaatttatttaaaaatt
ttaaaaacattgagtaaaaaaatcgatatacatttattttgtataaatccatgttgttta
tattggtttgatattgataatagattttatatctcaaatctaatcgaaaataaaattaaa
aataaaaaaaatttttttagaaaaaaaataaaaatttctttattatcattttggggttgt
ctgggggcaaaatatttaaaattattaaataatttaaatgaaaacatagaaaataaaatt
ttttataaaccaaaaaaagataatttgctgcatactattcaaaatgatattttatataat
aaatattataatataattatatcaaaaaagtttaataaatttgaaaaaaaaaatttacgc
gttttaaattcaaaagataattctatcacaattcatacttgtaaaaataaatatgaagaa
ataaattctctttataacttcatagtaaaaattactaaagataataaaaaaatttgtttt
aaagatattttagtaatggcgtcaaatatagaagactattcttcatacattaactctatt
tttaataatattaattacaaaataaattattttatttcagatattaaaatatatgaaaga
ttcaatattatttctgctatatttaacatattaaagttaccaaaatttaaattttctata
gaacaaattttttatctattagaattttcatctatttctaataagtttaaaatgaaagaa
gatgaaattaagatgttaaaatatttagttattaatttaggagttcaatggggtataagt
aataaaagatttaaaaaatgtaatgctaattttgaagaaaaatactcttggaataatata
ataaaaaaaacggtatcagaatattatacaagaataaacaataaagtttactttaaatat
atatactctaatgatttagatgaaaaaaagattaattctctaataaaattagaaaatttt
atttctaaattgaattattggtatgactatttatctcaacctcatttattatacgaatgg
aatgatgttataaaaaaaataataaaaaatttttttgatccagataaaaaagaaaattat
gttttagatttattaaaaaaaaattggaatgatattatttttcaaggaataaacacgaaa
tacaaaaaaacgatttatattgaaacattagaaaatatcttgtataaaagatttaagaaa
gaaaatttttttaaaaaaaataagtttaattcaatacatttttgtaatttaaaattatca
aaaataataccaagcaaaattatttgtttgttaggaattaatgatggaacttatcctagg
caagacataaattacaattttgattcaatttataaaaatttaaaaaacgatgataaaaat
ataagacaagaagatttatattctttcttaattattttgttatcttcaaaagaacatctt
tatataagttttattaaaaattatattaatgaagaaagatcaaaatatatttctataata
ataaatgaattaatagaatatatttctgtaagtttttatatcaaaaattgcaaatcatat
aattttttagaaaatattaataatataaaaaaaattttatttaaaaaatataataacttt
tatttttttagaaaagaaaaaatagaaatttttaataaaaaatattttttaaataacata
aatataaattcagataaaaaaattttttctaagatatcaataaacgaattttttttattt
tattctaatcctattaaattttggtgtaaaaaaaaattaaaaattaatttcagtaaagaa
catctttataaagataatgaatttattttaaaaaataaatttaatagctatagaataaat
ataatattatttgaatatttaattaaaaataaatatttaaataaaaaagatttattaaaa
aatacaattaaatatttttttgatggggtttttgaagaaattattatagaaaaaaaatat
tatcaaataataaaattaataaataatataaataaacatttattaatgaaaaaagaaaca
aaaaaagttttttttaaattagatcgtacaataatatttgggtggttgcctaatttacaa
aattccggattattaagatggaatcctaaaaatttatctttgcaagatggatttctgttt
tggatagaacatttgatttattgtatcataggaggaaaaggagatagcatttttttaggg
atagaatcatattggcattttaagaatataaattacaaaaaagcaaaacacttttttaaa
aaactcttggttgggtatgaattaggaattgaaaatccgatttttcttctaaataaatcc
ggaggagcatggataaatcattcttttaataaagaaaaaaataagttaattttagatgaa
aaaactaaaaaaaatgcccgttctaaattaatttctgcttggcaaggaaataagttcata
aatggagattctcaagacttttatatatctaaagttataccatttctaacagaaaataat
attaataaaattataaatgaatcaaaaaaatattttatttttccattaaaattcaataaa
ttattaaaataa

DBGET integrated database retrieval system