KEGG   Weissella cibaria: AO080_00360Help
Entry
AO080_00360       CDS       T04106                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
wcb  Weissella cibaria
Pathway
wcb00480  Glutathione metabolism
wcb00590  Arachidonic acid metabolism
wcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wcb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AO080_00360
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AO080_00360
Enzymes [BR:wcb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AO080_00360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALI32012
UniProt: A0A0N9YP46
Position
complement(70864..71340)
Genome map
AA seq 158 aa AA seqDB search
MTTVYDFKERTQGGQELDLQQFAGDVMVIVNTASKCGLAPQLTELQALYDQYQDEGFTII
GCPSNQFKQELDDASEIGAFCQKNYGVTFPMTEMMAVNGDDTAPLFDYLKAESGHGRIKW
NYTKFLVGRDGQLIARYAPTTAPSKMVKDIERALAATK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtttacgattttaaagaacgtacccaagggggccaagaactggacttgcaa
caatttgcaggggacgtgatggtgattgttaatacagcaagcaagtgtggcctagcgcca
caattgacagagctccaagccctgtatgatcaatatcaagatgaaggatttacgattatt
ggctgcccatctaatcaattcaaacaagaattggatgatgcttctgaaattggcgcgttt
tgccaaaaaaattatggcgtcacatttccaatgacagaaatgatggcagttaacggtgat
gacacggcgccgttattcgactatttgaaggctgagtctggtcacggtcgtattaagtgg
aattacacgaaatttttggttgggcgcgatggccaactcatcgcacgctatgcgccgacg
acagcgccaagcaagatggttaaggatattgaacgtgcgctcgcggctacaaagtaa

DBGET integrated database retrieval system