KEGG   Weissella cibaria: AO080_00775Help
Entry
AO080_00775       CDS       T04106                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
wcb  Weissella cibaria
Pathway
wcb00030  Pentose phosphate pathway
wcb00480  Glutathione metabolism
wcb01100  Metabolic pathways
wcb01110  Biosynthesis of secondary metabolites
wcb01120  Microbial metabolism in diverse environments
wcb01130  Biosynthesis of antibiotics
wcb01200  Carbon metabolism
Module
wcb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:wcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AO080_00775
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AO080_00775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wcb04147]
    AO080_00775
Enzymes [BR:wcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AO080_00775
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AO080_00775
Exosome [BR:wcb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AO080_00775
  Exosomal proteins of colorectal cancer cells
   AO080_00775
  Exosomal proteins of bladder cancer cells
   AO080_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ALI32087
UniProt: A0A0D1JKH6
Position
complement(158855..160318)
Genome map
AA seq 487 aa AA seqDB search
MPAEITTLLTFFGGTGDLAKRKLYPSTYNLFKKGFLQEHFAVIGTARQELTTEEFHEMVR
ESIADFVEDQANAEEFISHFYYIQQDITDSAAYADMLTLNNELDAKYGLKGNRIFYMSVA
PRFFGTVAKYLKSEGLITENGEYNRLMIEKPFGTSFGTAEDLQNELSEAFDDAQIFRIDH
YLGKEMVQNIAAVRFGNPLFDAAWNKDYIENVQVTLSEVLGVEERAGYYDTAGALRDMIQ
NHTMQIIGWLAMEKPASFKDTDIRAAKNAAFNSLKIYNREEVAENFVRGQYGESADGTQK
KYLDEMDVPADSQNNTFVAGKLQFEMPRWEGVPFYIRSGKRLAAKSTRVDVVFKKGLNIF
GGDVELANPVLTILIDPKGGIEFKINAKDVTSEFLTRVVNLNWTVSDEDKKLTPEPYERM
IHDAMDGNGSNFADWNGVAIAWKFVDAIQEAWDATREQFPNYVSGSMGPVASDELLAKDG
NEWVFKG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgcagaaattacaacattgttgacattcttcggtggaactggagatttggctaag
cgtaagttgtacccatcaacatacaacttgttcaagaagggcttcttgcaagaacacttc
gccgttattggaacggctcgtcaagaattgacgacagaagagttccacgagatggttcgc
gaatcaattgctgacttcgtcgaagaccaagcgaatgctgaagagtttatttcacacttc
tactacatccaacaagatattacggattcagctgcttatgcagatatgttgacgttgaac
aacgaattggatgctaagtacggcttgaagggtaaccgcattttctacatgtcagttgcc
ccacgtttctttggaacggttgccaagtacttgaagtcagaaggtttgattactgagaac
ggtgagtataaccgtttgatgattgaaaagccatttggaacatcatttgggactgctgaa
gatttgcaaaatgaattgtcagaagcttttgatgatgcccaaatcttccgtatcgaccac
taccttggtaaggaaatggttcaaaacattgcggctgtccgttttggaaacccattgttt
gatgcggcttggaacaaggattacatcgaaaacgtgcaagtcacgttgtcagaggttttg
ggtgttgaagagcgtgctggttactacgatacagccggtgctttgcgtgatatgattcaa
aaccacacgatgcaaatcattggttggttggcaatggagaagccagcatcatttaaggac
acggatattcgtgctgctaagaatgctgccttcaactcattgaagatttacaaccgtgaa
gaagttgctgaaaactttgtacgtggtcaatacggtgagtctgctgatggtacgcaaaag
aagtacttggatgaaatggacgtgccagctgattcacaaaacaacacatttgtggctggt
aagttgcaatttgagatgcctcgttgggaaggtgtgccattctacatccgttctggaaag
cgtttggctgctaagtcaacgcgtgtggatgttgtcttcaagaagggcttgaacatcttc
ggtggtgacgttgaattggcaaacccagttttgactattttgattgatcctaagggtggt
atcgaatttaagattaacgccaaggacgtgacatcagaattcttgacgcgtgttgttaac
ttgaactggacggtttcagacgaagacaagaagttgacgccagaaccatacgaacgtatg
attcacgacgcaatggacggtaacggatctaactttgccgactggaacggtgtggcaatt
gcttggaagttcgttgacgctattcaagaagcatgggatgcaacccgtgaacaattccct
aattacgtttcaggttcaatgggaccagttgcgtcagatgaattgttggccaaggatggc
aacgaatgggtcttcaagggctaa

DBGET integrated database retrieval system