KEGG   Weissella cibaria: AO080_03925Help
Entry
AO080_03925       CDS       T04106                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
wcb  Weissella cibaria
Pathway
wcb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:wcb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AO080_03925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wcb01007]
    AO080_03925
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wcb03016]
    AO080_03925
Enzymes [BR:wcb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AO080_03925
Amino acid related enzymes [BR:wcb01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AO080_03925
Transfer RNA biogenesis [BR:wcb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AO080_03925
 Prokaryotic type
    AO080_03925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 tRNA-synt_1d tRNA-synt_1c DUF1380
Motif
Other DBs
NCBI-ProteinID: ALI32649
UniProt: A0A0N9Y4F4
Position
832012..833427
Genome map
AA seq 471 aa AA seqDB search
MMKTFNTMSLEKETFTPINEKTINMYVCGPTVYNYIHIGNARSAIAFDTIRRYFEYRGYE
VNYVSNFTDVDDKMIAAASEQGITVPELADKYIDAFNEDTAPLNIKPATVRPRATEHIPE
IIEFVEDLIKKGYAYESEGDVYFRAKKFKGYGILAHQDLAEMESNAAGRLDDGELARKED
SMDFAVWKGENGDGAIAWNSPWGKGRPGWHIECSVMSTKYLGNHLDIHGGGIDLAFPHHT
NEIAQTEAHTGEKFVEKWLHNGFVTVGDENEKMSKSLGNFTTVHELLQQIDDPMVLRFFM
ATTQYRRPIAYSQKNMDLAARNLERIRTGYRNLQFRLGSAVAGSDADIEAKAQEKVDAFI
EAMDDDFNAQNAMTAVYELIELANLYSQAEEVKTDTVNFVLKQIKDLMNVFGVDGLEQAP
LLDADVDALIKERDAARETSNFARSDEIRDELASRGIILEDTPQGTRWRRA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaccttcaacacgatgagcttggaaaaggaaacttttacgcccatcaatgaa
aagacgatcaatatgtatgtctgcggaccaactgtttataactacattcacatcggtaat
gcacgttcagcgattgcattcgacacgatccgccgttacttcgagtatcgtggatacgaa
gtgaactatgtgtcaaacttcacggacgttgacgacaagatgattgctgcagctagcgag
caaggtatcaccgtaccagaattggctgataagtacattgatgcctttaacgaagacacg
gcaccattgaacatcaagcctgccactgttcgtccacgtgcaacggagcacatcccagag
attatcgaattcgttgaggatttgattaagaagggctacgcttacgaatcagaaggtgac
gtttacttccgtgctaagaagtttaagggttacggtattttggcccaccaagacttggct
gaaatggaatcaaacgctgctggtcgtttggacgatggcgaattggctcgtaaggaagac
tcaatggactttgcagtctggaagggtgagaatggcgatggtgcaattgcctggaactca
ccttggggtaagggacgtcctggttggcacatcgagtgctcagtgatgtcaacgaagtac
ttgggaaaccacttggacatccacggtggtggaatcgatttggctttcccacaccacaca
aacgaaatcgcacaaactgaagctcacacgggtgaaaagttcgttgagaagtggttgcac
aacggtttcgttacggttggtgatgaaaacgaaaagatgtcaaagtcattgggaaacttc
acgactgtgcacgaattgttgcaacaaatcgatgatccaatggttttgcgtttcttcatg
gctacgacacaataccgtcgtccaattgcctactcacaaaagaacatggacttggctgcc
cgcaacttggagcgtatccgcactggttaccgtaacttgcaattccgtttgggatcagca
gttgccggttcagatgctgatatcgaagcaaaggcgcaagaaaaggttgatgcctttatt
gaggctatggacgatgacttcaacgcacaaaacgcgatgactgcggtttatgagttgatt
gaattggctaacttgtactcacaagctgaagaagttaagactgacacggtcaactttgtt
ttgaagcaaatcaaggacttgatgaacgtgtttggtgttgatggtttggagcaagcgcct
ttgttggatgcagatgttgatgcattgatcaaggaacgtgatgctgcccgtgagacgtca
aactttgctcgttcagacgaaattcgtgatgaattggcttcacgtggcattatcctagaa
gatacgccacaaggaacgcgttggcgtcgtgcctaa

DBGET integrated database retrieval system