KEGG   Weissella cibaria: AO080_05615Help
Entry
AO080_05615       CDS       T04106                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
wcb  Weissella cibaria
Pathway
wcb00670  One carbon pool by folate
wcb01100  Metabolic pathways
wcb01120  Microbial metabolism in diverse environments
wcb01200  Carbon metabolism
Module
wcb_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:wcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AO080_05615
Enzymes [BR:wcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AO080_05615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Cluap1
Motif
Other DBs
NCBI-ProteinID: ALI32952
UniProt: A0A0N7HAQ1
Position
1208554..1210215
Genome map
AA seq 553 aa AA seqDB search
MQTDIEIAQAAEVWPIEKIAEKAGLTPAEWEPYGRDKAKISVDETAHKSELGKLVLVTSI
NPTPAGEGKSTVTVGLADALNGIGQQTMVALREPSLGPVMGLKGGATGGGYAQVVPMADI
NLHFTGDFHALTSAHNTLAAVIDNSIYQGNPLHIDPRWLLWKRALDVNDRALRHVTIGLG
GPTSGVPREDGFDITVASELMAILTLSHDLMDMKARIERIVIGYTYDKEPVTVKDLGVAG
ALTTLLKDAIKPNLVQTLAHTPALIHGGPFANIAQGTNSIRATKTALQLADYVVTEAGFG
ADLGGEKFLDFKTPLLGKHPDVIVVVATVRALKMHGGLPKTALTEPDEQALATGLANLGQ
HLQSMTRYGVPVIVAVNRFVTDTPEEIAMVEAYARDFGVQAYVADVWAKGGAGATELASA
VAEAAQVASDFKPLYEADDDAVVKIEKIVQTIYGGAGVELSDKAAKQLREFAKRGWDKLP
VIMAKTQYSLSDDAKKLGAPKDFKIHVREFIPKLGAGFLVVMTGTVLTMPGLPSHPAAYD
IDIDENGRITGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagatattgaaattgcacaagctgcagaagtgtggcccattgaaaaaattgct
gaaaaggccggcttaacgccagcggaatgggaaccatacggtcgtgataaggccaaaatt
tcagttgatgaaacggctcacaagtctgaacttggtaagttggtcttggtgacgtcaatt
aatccaactccggctggtgaaggtaagtcaacggtgacggtcggactagctgatgcttta
aatggaattggccagcaaacaatggtggctcttcgtgaaccttctttgggcccggtaatg
gggcttaagggcggtgcaactggtggcggctatgctcaagttgtgccgatggctgatatt
aatttgcattttaccggcgattttcacgccttaacgagtgctcacaatacgttggcggcc
gtcattgataatagtatttatcaaggcaatccgttgcacattgacccacgctggttactt
tggaagcgtgctttggatgttaatgatcgtgctttgcgtcacgtgacaattggcttgggt
ggaccgacttcaggtgtgccacgtgaagatggcttcgatattacggttgcatcagagctg
atggctattttgactttgtcacacgacttgatggacatgaaagcacgcattgaacgcatt
gtcattggttacacatatgacaaagagccggtcacagttaaggatttgggtgttgcaggt
gcgttgacgactttgttgaaggatgccattaagccaaacttggtccagacgttggctcac
acgccagctttaattcacggtgggccatttgccaacattgcccaaggtaccaactcaatt
cgtgcaactaagacggcgctacaattagcagactatgtggtgactgaagccggttttggg
gctgatttgggtggtgaaaagttcttagactttaagacaccattgcttggcaagcatccc
gatgtcattgtagttgtggcgacagtccgagcactcaagatgcacggcgggttgcccaaa
actgcgctaacggaaccggatgaacaggcgttggctactggtttagcgaaccttgggcaa
catctgcaaagcatgacccgctatggtgtccctgttatcgtggctgttaatcgctttgtg
acagacacaccagaagaaattgccatggttgaagcttatgcacgcgactttggtgtgcag
gcctatgttgctgacgtttgggctaagggtggtgccggcgctactgagttagctagtgcg
gtcgctgaagcagcgcaagttgcaagtgactttaagccattatacgaagctgatgatgat
gcagtggtgaagattgaaaaaatcgtccagaccatttatggtggcgctggggttgagttg
tcagataaggcagctaagcaattgcgcgaatttgctaaacgtggttgggacaagttacca
gtcattatggctaagacgcagtattcattgtctgatgatgctaaaaaattgggtgcgcca
aaggactttaagattcatgttcgtgaattcattccgaagttgggcgcaggcttcttggtg
gtgatgaccggtacggtgctaaccatgcctggtttgccaagtcacccagctgcctatgat
attgatatcgatgaaaacggccggattaccggactgttctag

DBGET integrated database retrieval system