KEGG   Weissella ceti WS08: WS08_0111Help
Entry
WS08_0111         CDS       T03228                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
wce  Weissella ceti WS08
Pathway
wce00520  Amino sugar and nucleotide sugar metabolism
wce01100  Metabolic pathways
wce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WS08_0111
Enzymes [BR:wce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     WS08_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIG65050
UniProt: A0A075TXW6
Position
136690..137868
Genome map
AA seq 392 aa AA seqDB search
MSKVLTHVAIYTGDEENPVIKDGFIRFDTTIEAMGSMKAFVPLASDDVTRGDRQVVVPGF
VDVHAHGAYGFDTMDGKASDIVNMAHGQITEGITSVFPTTMTQAVENIDQAMLAINEAAQ
EEPSIVGVHLEGPFINPHYKGAQPEQYIIAPSVELVEKWHHMSGDRVRLITYAPEQADDL
AAFESYLLENNIIGSVGHSNATREFLQNESKASHITHLYNAQRPMSHREPGVAGHAMLEN
SVRAEMIVDGFHIKPDMVKLAYQMKSADRIDLITDSMRAKGLGDGESELGGQKVWVADKQ
ARLEDGTLAGSVLEFDDAFRNIMAFTGASVHEAVKMSSVNQAEEFGLTQKGALQVGKDAD
FNVFNADFSNLDATYSLGRRFTKADAPKGEMI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtcttaacacatgtagccatctatacaggtgatgaagaaaatccagttatc
aaggatgggtttattcgttttgatacaacaattgaagctatgggaagtatgaaggcgttc
gtaccgcttgcatctgatgatgtaacacgtggtgatcgtcaagtggttgtgccaggattc
gttgatgtgcatgcacacggtgcatacggtttcgatacaatggatgggaaagcatctgac
atcgtgaatatggcacatgggcaaattactgaaggaatcacgtcagtatttccaacaaca
atgacacaagctgttgaaaacattgatcaagcaatgttggcgattaatgaagcagcgcaa
gaagaaccatcaatcgttggggttcatttggaagggccatttatcaacccacactacaag
ggtgcacaaccagaacaatacattattgccccttcagttgaattggttgaaaagtggcac
cacatgtctggggaccgtgtgcgtttgattacgtacgcaccagaacaagcggatgatcta
gcggcctttgaaagctacttgttggaaaacaacattattggttcagtgggacattcaaat
gcaactcgcgaattcttgcaaaatgaatcaaaggcaagtcacattacacacttgtacaat
gcgcaacgtccaatgagtcaccgtgaaccaggtgtggccggacatgcgatgttggaaaac
agtgtgcgtgccgaaatgatcgtcgatggattccacatcaagcctgacatggtgaagcta
gcttaccaaatgaagtctgctgaccgtattgatttgattacagattcaatgcgcgccaag
ggacttggggatggtgaatctgaattaggtggacaaaaggtttgggttgctgacaagcaa
gcacgtcttgaagacggaactttagctggttcagtacttgaatttgacgatgctttccgt
aacattatggccttcacaggggctagtgtgcatgaagcagttaagatgtcatcagttaac
caagctgaagaattcggtttgacacaaaagggtgccttgcaagtcggtaaggatgctgac
tttaacgtgttcaatgctgatttctctaacttggatgcaacttacagtctagggcgtcgc
tttactaaggctgatgcacctaaaggagaaatgatttaa

DBGET integrated database retrieval system