KEGG   Weissella ceti WS08: WS08_0644Help
Entry
WS08_0644         CDS       T03228                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wce  Weissella ceti WS08
Pathway
wce00071  Fatty acid degradation
wce00072  Synthesis and degradation of ketone bodies
wce00280  Valine, leucine and isoleucine degradation
wce00362  Benzoate degradation
wce00620  Pyruvate metabolism
wce00630  Glyoxylate and dicarboxylate metabolism
wce00640  Propanoate metabolism
wce00650  Butanoate metabolism
wce00900  Terpenoid backbone biosynthesis
wce01100  Metabolic pathways
wce01110  Biosynthesis of secondary metabolites
wce01120  Microbial metabolism in diverse environments
wce01130  Biosynthesis of antibiotics
wce01200  Carbon metabolism
wce01212  Fatty acid metabolism
wce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS08_0644
   00630 Glyoxylate and dicarboxylate metabolism
    WS08_0644
   00640 Propanoate metabolism
    WS08_0644
   00650 Butanoate metabolism
    WS08_0644
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS08_0644
   00072 Synthesis and degradation of ketone bodies
    WS08_0644
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS08_0644
   00310 Lysine degradation
    WS08_0644
   00380 Tryptophan metabolism
    WS08_0644
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS08_0644
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS08_0644
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS08_0644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wce04147]
    WS08_0644
Enzymes [BR:wce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WS08_0644
Exosome [BR:wce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS08_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIG65583
UniProt: A0A075U052
Position
complement(725705..726883)
Genome map
AA seq 392 aa AA seqDB search
MVKRVFIVGAKRTPIGKFGGALASKTAAMLGGLAIEGALNQAQLPTEANVDQVFMGNVLQ
AGSGQNPARQASQLAGLGDGVPAVTMNDVCGSGLTSINLAAAMIQSGQADIMVAGGMESM
SNAPYVLDKARFGYRLGDGMMRDTILSDALTDAEGDFHMGITAENVAQKYDISREAMDAF
SLASHQKAAAAIERGDFDTEIVPVPVTVKRETTMITQDEGPRPDSSLEKLARLKPAFQED
GRVTAGNASGINDGAAAIVLVSEDALEQYGLTALAEWQGASLVGLDPTLMGVGPYYAVDK
LLGNADLTVDDINVFELNEAFAAQALASNQLLTVDEARVNPRGGAIALGHPVGASGARVL
VSLIHELQPEERGVAALCIGGGMGVSALITRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcgagtatttattgttggtgcgaaacgaacaccaatcggtaagtttggtggt
gcgttagcaagcaaaaccgctgctatgttgggtggattagcgattgaaggtgcgctaaac
caagcacaattacctactgaagcaaacgtggatcaagttttcatgggaaatgtgcttcaa
gccggttcaggacaaaatccagctcgtcaagccagtcaactagcaggtcttggggatggt
gtccctgcggttacgatgaatgatgtctgtggttctggattaacaagtattaatctagcc
gcagcaatgattcaatcaggtcaagcggatatcatggttgctggtggaatggaaagcatg
tcaaatgcgccatatgtgttagataaagcgcgttttggttaccgtctgggtgacgggatg
atgcgtgatacgattctatcagatgccttgactgatgctgaaggcgatttccatatgggg
attaccgctgaaaacgtggcgcaaaagtatgacattagccgtgaagcaatggacgcattt
agtctagctagtcaccaaaaagccgctgcggcaatcgaacgtggggattttgatacagaa
attgtgccagttcctgttacagtgaagcgtgaaacaacgatgattactcaggatgaaggg
cctcgaccagactcaagtttagaaaagctagcacgtctaaagcctgctttccaagaagat
ggtcgcgtcacagcggggaatgcatcagggattaacgatggtgccgctgcgattgtgttg
gtcagcgaagatgccctagaacaatatggactaacagccttggctgaatggcaaggcgca
agtctagttggattggatccaacattgatgggtgtcggaccttactacgcggttgataag
ttacttggtaatgctgacttaacggtagatgatatcaatgtctttgagttaaatgaagct
tttgcagcgcaagccttggcaagtaatcaattactaacagtagatgaagcgcgtgtgaac
ccacgtggtggagccattgctttgggacatcccgtaggtgcatctggtgcgcgtgtgctt
gtaagtttaattcatgagctacaaccggaagaacgtggagttgcggcactatgtatcggt
ggtggtatgggtgtatcagcattgattacacgtcgttaa

DBGET integrated database retrieval system