KEGG   Weissella ceti WS08: WS08_0968Help
Entry
WS08_0968         CDS       T03228                                 

Definition
(GenBank) Putative chlorophyll synthesis pathway protein BchC
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
wce  Weissella ceti WS08
Pathway
wce00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:wce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WS08_0968
Enzymes [BR:wce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WS08_0968
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WS08_0968
    1.1.1.-  
     WS08_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_N_assoc ADH_zinc_N_2 Pyr_redox_2 Glu_dehyd_C PALP Pyr_redox TrkA_N 2-Hacid_dh_C Pyr_redox_3 FAD_binding_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AIG65907
UniProt: A0A075U731
Position
complement(1058601..1059650)
Genome map
AA seq 349 aa AA seqDB search
MMKAAVWHGVKDVRVEDVELKPTKDNEVVVKVAYAGICGSDLHEYLEGPVFIPVEKMDAL
TGGQAPITMGHEFSGVVERVGKDVTKVKVGDHVAVNPTVTHMDSADDVDVYDGYSFLGLS
TDGGFTELVNVPEVNIYPLPEDFSLRLAATIEPAAVAVQAVKEGGLKFGQKVVIFGSGPI
GVLVAAAAKAAGATKIVVVDLSDVRLEKALAMGATDVINPAKVEDTVAAIKEIIPGGADV
SFEVAGVQATFEQAIDSTKPRGTSVIVSIFAKPISFNPMQLMNSGVKLTTTIAYSRESFQ
QTVDLVSQGLLDVAPVITDEIVLDDIVTKGFESLTTDKSQAKILVDLSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcagcagtatggcatggtgtaaaggatgttcgagtagaagacgtagaattg
aagccaacgaaggacaacgaagttgtcgttaaggtggcctatgctggtatttgtggaagt
gacttgcacgaatatttggaaggacccgttttcattcctgttgaaaagatggatgcattg
actggtggacaagcaccaatcacaatgggacacgagttctcaggtgtggtagaacgtgtt
ggtaaagatgtgacaaaggttaaggttggagatcatgtcgcagttaacccaactgttacc
cacatggattcagcagatgatgttgatgtttacgatggttacagcttcttgggattgagt
actgatggtggattcactgaattggttaacgtacctgaagtgaacatctacccattacca
gaagacttctcacttcgtttggccgccacaatcgaaccagctgccgtagcggtgcaagct
gttaaagaaggtggtttgaagtttggacaaaaggttgttatcttcggttcaggaccaatt
ggtgtactagtcgctgcggcagcgaaggctgctggagccactaagattgtggttgtggac
ctatcagatgttcgtttggaaaaggccttggcaatgggcgcaacagatgtaatcaaccca
gccaaggttgaagatactgtggccgctattaaggaaatcatcccaggtggtgcggacgta
tcattcgaagttgccggagttcaagcaacatttgaacaagcaattgacagcacaaagcca
cgcggaacatcagttatcgtgtcaatctttgcaaagccaatctcattcaacccaatgcaa
ttgatgaattcaggagttaagctaacaacaacgattgcttactcacgtgaatcattccaa
caaacagttgatttggttagccaaggattactagatgttgcgccagttattactgacgaa
attgtcttggatgacattgtcactaagggattcgaatcactaacaacagacaagtcacaa
gctaagattttggttgatttgtcaaaataa

DBGET integrated database retrieval system