KEGG   Weissella confusa: C6P13_04600Help
Entry
C6P13_04600       CDS       T05951                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
wcf  Weissella confusa
Pathway
wcf00471  D-Glutamine and D-glutamate metabolism
wcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C6P13_04600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:wcf01011]
    C6P13_04600
Enzymes [BR:wcf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     C6P13_04600
Peptidoglycan biosynthesis and degradation proteins [BR:wcf01011]
 Precursor biosynthesis
  Racemase
   C6P13_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: QBZ02562
Position
976147..976992
Genome map
AA seq 281 aa AA seqDB search
MDNRAIGYIDSGIGGLTVVKQALLQIPDEQVYYVGDTARMPYGPRPQDEVLGFTWQMVNY
LLKKDIKMLVVACNTATAAALPDLQAKLDIPVVGVIQPGVDAALRKSTDGEIGVIATAGT
VKSLAYYNGLLQGNRAANVVQLAAPEFVDVAENHDYTSEFARQVVKEKLTYFKNHQVDTL
ILGCTHFPLMEGFIQEAMGPKVTLVNSGAETISTVVEFLDKYDLRHAAANPADHTNDEYF
TTGSVKRFATIGGRWLDDKEMTVKHLDIVGDTLVLNESVTD
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggataatcgtgcaattggttacatcgattctggtatcggtgggttgaccgtggtcaag
caagccttgctgcaaattcctgatgaacaagtctactacgtgggggacacggcgcgtatg
ccttatggtccacgcccacaggatgaagtcctcggcttcacttggcaaatggttaattat
ttgctgaagaaggatatcaagatgctggtcgtagcctgcaataccgcgactgcagccgca
cttcctgaccttcaagctaagctagacatcccagttgttggtgttatccaacctggtgtc
gatgccgctttgcgtaagtcaacggatggtgaaattggtgttatcgcaacggccggaaca
gttaagtcattggcttactacaatggtttgttgcaaggaaaccgtgcagctaacgttgta
caacttgctgcaccagaattcgttgatgtggccgaaaatcacgactacacctcagaattt
gctcgccaggtggttaaggaaaagttgacgtactttaagaaccaccaagttgatacgttg
attcttggatgcacgcacttcccattgatggaaggcttcattcaagaagcgatgggacct
aaggtaacgttggttaactctggtgccgagacgatttcaacggttgtcgagttcttggac
aagtatgatttgcgtcatgctgcagcaaacccagctgatcacacaaacgacgaatacttt
acgactggtagcgtaaagcgctttgctacgattggtggtcgttggttggatgataaggaa
atgacagttaagcacttggatatcgttggtgatacactagtgttgaatgaatctgttaca
gactaa

DBGET integrated database retrieval system