KEGG   Weissella confusa: C6P13_05255Help
Entry
C6P13_05255       CDS       T05951                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
wcf  Weissella confusa
Pathway
wcf00230  Purine metabolism
wcf00240  Pyrimidine metabolism
wcf01100  Metabolic pathways
wcf01110  Biosynthesis of secondary metabolites
Module
wcf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
wcf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
wcf_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:wcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C6P13_05255
   00240 Pyrimidine metabolism
    C6P13_05255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:wcf04131]
    C6P13_05255
Enzymes [BR:wcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     C6P13_05255
Membrane trafficking [BR:wcf04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    C6P13_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF2220
Motif
Other DBs
NCBI-ProteinID: QBZ02687
Position
1098448..1098870
Genome map
AA seq 140 aa AA seqDB search
MSEERTLVLIKPDGVARGLMGEVFSRLERKGYKITSLLMTEATEEQLRRHYAEKVNAPYF
PEILEYMTSGPLVAMVVTGTNIVKNFRAMAGVTNPSEAAPGTIRGDYGRDWEDGAVRNIV
HSSDSVENAEREISIWFENH
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaacgaacattggttttgattaagccagatggtgttgcacgtggtttgatg
ggggaagtcttttcacgtttggaacgtaagggctacaagattacgtcgctgttgatgaca
gaggcgacagaagaacagctacgtcgtcactacgccgaaaaggtcaatgcaccttatttc
ccagaaattttggagtatatgacaagcggtccattagttgcgatggtggtaacagggaca
aacatcgtgaagaatttccgtgcgatggctggtgtaacgaatccaagtgaggcagctccc
ggcacgattcgtggtgattatggtcgcgattgggaagatggtgccgtacgtaacatcgtc
cacagttctgacagtgttgaaaatgccgaacgcgaaattagcatttggtttgaaaatcac
taa

DBGET integrated database retrieval system