KEGG   Weissella confusa: C6P13_05415Help
Entry
C6P13_05415       CDS       T05951                                 

Definition
(GenBank) 3-oxoacyl-ACP reductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
wcf  Weissella confusa
Pathway
wcf00030  Pentose phosphate pathway
wcf01100  Metabolic pathways
wcf01120  Microbial metabolism in diverse environments
wcf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C6P13_05415
Enzymes [BR:wcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     C6P13_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1859
Motif
Other DBs
NCBI-ProteinID: QBZ02718
Position
1132055..1132873
Genome map
AA seq 272 aa AA seqDB search
MTINHTKDSTRYPDLRGKTAVVTGSSSGIGEAIARHMGSEAMNVVINYINADEKVIDGLI
YLIEQSGGRAVGIRADVGTEAGVQAIYDKAIEAFGDIDVWVNNAGFEIQSETHETSYEDW
QRVLHVDLDGVFLGTKIAVQHFLKHNKKGNILNTSSIHDIIPWPTYASYATAKAGVLMFT
KTTALEYAERGIRINAISPGALETPINAQRFADPAVRADTEGMIPMKKVGDPVDVANAAV
WLISNEASYITGTTLYIDGGITLYNEFQGGRG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaatcatacaaaagactcaacccgttatcctgatttacgtgggaaaacagcg
gttgtaactggaagttcttctggtattggtgaagcgattgcacgtcacatgggatctgaa
gcgatgaacgtggttattaactacatcaacgctgacgaaaaggtgattgatggtttgatt
tacctaatcgaacaatcaggcggacgtgcagtgggaattcgtgccgatgttggaacagaa
gctggtgtgcaagcgatttacgacaaggcgattgaagcctttggcgatatcgacgtttgg
gttaacaatgccggtttcgagattcaatcagaaacgcacgaaacatcatatgaagactgg
caacgtgtgcttcacgttgacttggatggtgttttcttgggaactaagattgccgtacaa
cacttcttgaagcataacaaaaagggtaacatcctaaacacctcatcaattcacgacatt
atcccttggcctacgtatgcttcatacgcaacggcaaaggctggtgtcttgatgtttaca
aagacaacggcgcttgagtatgctgaacgtggcattcgtatcaatgccatttcaccaggt
gctctggaaacgccaattaacgcacaacgtttcgctgatccagcggttcgtgccgacacg
gaaggcatgattccaatgaagaaggtcggtgatccagtcgatgtcgctaacgcagctgtg
tggctgatttctaacgaagcctcatacattacgggaacgacattgtatatcgacggtggt
attacgctttacaacgagttccaaggtggtcgcggttaa

DBGET integrated database retrieval system