KEGG   Weissella confusa: C6P13_07520Help
Entry
C6P13_07520       CDS       T05951                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
wcf  Weissella confusa
Brite
KEGG Orthology (KO) [BR:wcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:wcf03009]
    C6P13_07520
Enzymes [BR:wcf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     C6P13_07520
Ribosome biogenesis [BR:wcf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C6P13_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: QBZ03122
Position
complement(1566754..1567671)
Genome map
AA seq 305 aa AA seqDB search
MTEETLVITDQTGRLDKVVADAFEDYTRTQVTGWINDGVLKVNGAEKKAKYSVKPGDEIT
FTVPEPVEIDLKPEDIPLDIVYEDDDLLVVNKPQGMVVHPALGHESGTLVNALMFHTPLS
TINGVVRPGIVHRIDKDTSGLLMVAKNDKAHEALSAQLKDKKNLRQYYALVHGEFIENEG
TIKAPLGRSSADRKKQAVVAGGRDAVTHFKVVKRFVGYTLLQVTLETGRTHQIRVHMAYI
GHPVAGDPLYGPKKTLPGNGQYLHAATLGLTQPTTGEEMTFEAPLPSYFTEMLDQLDPYA
EIDAN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagagacattggtaatcacggaccagactggccgtcttgataaggtcgttgct
gacgcgtttgaagattatacacgtacccaagtgactggctggattaacgacggcgtattg
aaggtgaatggtgccgagaagaaggccaagtacagcgtaaagcctggcgacgagattacc
tttacggttcctgagccagttgagattgacctgaagccagaagacatcccattggacatc
gtttatgaagatgatgacctattggttgtgaacaagccacaagggatggttgtgcaccca
gctttgggtcacgaatcaggtacattggttaacgcgttgatgttccacacgccactttca
acgattaacggggtggttcgtcctggtatcgtgcaccgcattgacaaggacacgtcaggt
ttgttgatggttgctaagaacgacaaggcacacgaggctttgtcagcacaattgaaggac
aagaagaacttgcgccaatattacgcccttgttcacggtgaattcattgaaaacgaagga
accatcaaggcaccattgggtcgctcatcagctgaccgtaagaagcaagcggttgtggct
ggtggtcgtgacgccgtgacccactttaaggttgtgaagcgttttgtgggttacacgcta
ttgcaagtaacgcttgaaacgggtcgtacgcaccaaattcgtgtgcacatggcttacatt
ggtcacccagtggctggtgatccattgtacggaccaaagaagacgttgccaggtaacggt
caatacttgcacgcggcaacgcttggtttgacgcaaccaacgacgggtgaagaaatgacg
tttgaggcgccattaccatcgtactttacagaaatgttggatcaattagacccatatgca
gaaattgacgcaaactaa

DBGET integrated database retrieval system