KEGG   Waddlia chondrophila: wcw_1042Help
Entry
wcw_1042          CDS       T01255                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
wch  Waddlia chondrophila
Pathway
wch00230  Purine metabolism
wch00240  Pyrimidine metabolism
wch01100  Metabolic pathways
wch03030  DNA replication
wch03430  Mismatch repair
wch03440  Homologous recombination
Module
wch_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:wch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    wcw_1042
   00240 Pyrimidine metabolism
    wcw_1042
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    wcw_1042
   03430 Mismatch repair
    wcw_1042
   03440 Homologous recombination
    wcw_1042
Enzymes [BR:wch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     wcw_1042
DNA replication proteins [BR:wch03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     wcw_1042
DNA repair and recombination proteins [BR:wch03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     wcw_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ADI38401
UniProt: D6YW90
Position
complement(1122243..1122671)
Genome map
AA seq 142 aa AA seqDB search
MRFFKMNIRFLKTTDNVTKLRRISASVEHYFLKKKRVLITVPSETAATYLDDFLWKQPKE
GFLPHSVSTQACSDEIVITTKQENLNQAEILINLCSEFSPIAGQFKTVFELWDETNALRR
EQSEKKFKAYEASGMKVELFRC
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagattcttcaagatgaacatccgatttctgaagacaacagataatgttacgaaattg
cggcgtattagcgcttcagtagagcactattttcttaagaaaaaacgcgtactgattact
gtcccctcagaaactgccgcaacctatctagatgattttttatggaagcagccaaaagag
ggtttcctgccgcattctgtctcgacacaagcttgttcagacgagattgtgattacaacg
aaacaggaaaatcttaatcaagctgaaattctcattaatctttgttctgagttttcgccg
attgccggacagtttaagactgtgttcgaattgtgggatgaaacaaatgcattgcgacga
gagcagtctgaaaaaaagtttaaagcttacgaagcttcagggatgaaagttgaattattt
cgatgttga

DBGET integrated database retrieval system