KEGG   Waddlia chondrophila: wcw_1117Help
Entry
wcw_1117          CDS       T01255                                 

Gene name
mvaA
Definition
(GenBank) putative Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
wch  Waddlia chondrophila
Pathway
wch00900  Terpenoid backbone biosynthesis
wch01110  Biosynthesis of secondary metabolites
wch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wch00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    wcw_1117 (mvaA)
Enzymes [BR:wch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     wcw_1117 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ADI38474
UniProt: D6YWG3
Position
1195988..1197223
Genome map
AA seq 411 aa AA seqDB search
MIPSNFRKLTPVQRRDALKALYLIDDDELQLLANQTDLTELSDILVESSIGTFPIPLGIA
TGFLVDRCLKFIPMATEEPSVIAAASYAAHLIKAGEGFTTWADSPVMTTQIFLKEAKHLS
LQTCKEKIGSHVNAIIPRMVQRGGGFRGVSTERKEDTLLVSIDVDVCDAMGANVMNTVAE
GMKDYLSNLFEGRVLMSILTNASSKRKAGASFKVPVKLFRKGGLSGLEACQRIVEANQTA
QLFPERAVTHNKGVMNGISALALATGNDTRAIESAAHFYAQKTGQYLPLTTYEISDNSLK
GNIELPLALGTVGGTTSFWPASRFALKLLSCPDAQSLNKLAAALGLAQNLAALFALVSDG
IQGGHMKLHAAKAAYAAGARGESIRQIGETLWNERKLDIEEAKKVLEKTTS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgattccttctaattttcgcaagctcacacctgtccaacgtcgagacgctttaaaagct
ctctacctgattgatgatgatgaattgcaacttcttgcaaaccaaacagacttgacagag
ctttccgatattctggtcgaatcatcgatcggaacctttccaattcctttaggaatcgca
acaggtttcctggttgaccgctgtctaaaatttatccctatggctacagaagagccttcc
gtcatcgctgccgccagctatgcagcgcatctgattaaagctggtgaagggttcacgact
tgggctgattcaccagtgatgaccacacagattttcctcaaagaagctaagcacctctca
ttgcaaacgtgcaaagaaaaaatcggctcgcatgtcaacgcgatcattcctcgaatggtt
caacgcggaggcggcttcagaggtgtttcaacagagagaaaagaagacacattactcgtt
tcgatcgatgttgacgtctgcgatgccatgggtgcgaatgtgatgaacactgttgcagaa
gggatgaaggactatctttcaaaccttttcgaaggccgagtgctcatgtccatcttaacc
aatgcatcttcaaaaagaaaggcaggtgcatcattcaaagtcccggtaaagctgttcaga
aaaggaggcctgtccgggttggaggcatgccaacggattgtcgaagcaaatcaaacagct
caactgtttcccgaacgcgcagtcacgcataataaaggggtaatgaacggcatttcggca
ctagcgctggcaaccggcaacgatacgcgtgcgatagaatcagcagcgcatttttacgca
caaaaaacaggtcaataccttccattgacaacatacgaaatctcagacaactctcttaaa
ggaaacatagagcttccccttgctttaggaactgtcggtggaacaacaagtttttggccc
gcttctcggtttgcattaaaattgctttcctgtcccgatgcgcaatctctgaataagcta
gctgcggctctggggcttgcccaaaatctggcagctctttttgcccttgtttctgacgga
atacagggaggacacatgaagctgcacgcagcaaaggcagcctacgccgctggcgcccgc
ggagaatcgattcgccaaataggagaaactctttggaacgagagaaaacttgatattgaa
gaagcaaaaaaagttctggagaagacaacatcatga

DBGET integrated database retrieval system