KEGG   Weissella ceti WS105: WS105_0373Help
Entry
WS105_0373        CDS       T03295                                 

Definition
(GenBank) Glycine--tRNA ligase alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
wci  Weissella ceti WS105
Pathway
wci00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:wci00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WS105_0373
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wci01007]
    WS105_0373
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wci03016]
    WS105_0373
Enzymes [BR:wci01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     WS105_0373
Amino acid related enzymes [BR:wci01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   WS105_0373
Transfer RNA biogenesis [BR:wci03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    WS105_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AIM63963
UniProt: A0A075TUS2
Position
431424..432353
Genome map
AA seq 309 aa AA seqDB search
MSTKMSVQDIILTLQTFWAKQGAMLMEAYDTEKGAGTMSPYTFLRANGPEPWNAAYVEPS
RRPADGRYGDNPNRLYQHHQFQVVMKPSPDNIQELYLESLEALGIDPLAHDIRFVEDNWE
NPSMGAAGIGWEIWLDGMEVTQFTYFQQVGGIPVDAVTSEITYGLERLASYIQDVPTVYD
LEWGNGVLYGDIFKEPEFEHSTYSFDTSDAEMLLRHFNEYEVEAKRALEAGLVHPAYDYI
LKASHTFNLLDARGTVSVTERAKYLSRIRNMARMVAKAFIAERKKLGFPLLKDEALREKY
LPTQEEEAK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaaatgagtgtccaagatattattttaacgcttcaaacattctgggcgaag
caaggtgccatgttaatggaagcctacgatactgaaaagggagctgggactatgagccca
tacacgttcttacgtgcgaatggaccagaaccttggaatgctgcctatgttgaaccatca
cgtcgtccagcggatggacgttatggagacaaccctaatcgtttgtaccaacaccaccaa
ttccaagtggttatgaagccatctcctgataacattcaagaactatacctagaatcattg
gaagcattgggaattgatccacttgctcacgatattcgtttcgttgaagataactgggaa
aacccatcaatgggtgcggctggaatcggttgggaaatctggttagacggaatggaagtg
acgcaatttacgtacttccaacaagttgggggaatcccagttgatgccgttacatcagaa
atcacatacggtttggagcgtttggcgtcatacattcaagacgtaccaactgtttacgat
ctagaatggggaaatggtgttctttacggtgacatctttaaggaaccagaattcgaacac
tcaacatactcatttgatacatctgatgcagagatgttattgcgtcacttcaatgaatac
gaagttgaagcaaagcgtgcattggaagctggtttagtacaccccgcctatgactacatt
ctaaaggcatcacacacatttaacttgttagatgcacgtggaacggtatctgttacagaa
cgtgcgaagtacttgagccgtatccgtaacatggctcgtatggtggctaaggcctttatc
gctgaacgtaagaagcttggtttccctcttttgaaggacgaagcattgcgtgaaaagtac
ttaccaacgcaagaagaggaggccaagtaa

DBGET integrated database retrieval system