KEGG   Weissella ceti WS105: WS105_0706Help
Entry
WS105_0706        CDS       T03295                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wci  Weissella ceti WS105
Pathway
wci00071  Fatty acid degradation
wci00072  Synthesis and degradation of ketone bodies
wci00280  Valine, leucine and isoleucine degradation
wci00362  Benzoate degradation
wci00620  Pyruvate metabolism
wci00630  Glyoxylate and dicarboxylate metabolism
wci00640  Propanoate metabolism
wci00650  Butanoate metabolism
wci00900  Terpenoid backbone biosynthesis
wci01100  Metabolic pathways
wci01110  Biosynthesis of secondary metabolites
wci01120  Microbial metabolism in diverse environments
wci01130  Biosynthesis of antibiotics
wci01200  Carbon metabolism
wci01212  Fatty acid metabolism
wci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS105_0706
   00630 Glyoxylate and dicarboxylate metabolism
    WS105_0706
   00640 Propanoate metabolism
    WS105_0706
   00650 Butanoate metabolism
    WS105_0706
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS105_0706
   00072 Synthesis and degradation of ketone bodies
    WS105_0706
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS105_0706
   00310 Lysine degradation
    WS105_0706
   00380 Tryptophan metabolism
    WS105_0706
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS105_0706
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS105_0706
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WS105_0706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:wci04147]
    WS105_0706
Enzymes [BR:wci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WS105_0706
Exosome [BR:wci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS105_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIM64296
UniProt: A0A075U052
Position
complement(760630..761808)
Genome map
AA seq 392 aa AA seqDB search
MVKRVFIVGAKRTPIGKFGGALASKTAAMLGGLAIEGALNQAQLPTEANVDQVFMGNVLQ
AGSGQNPARQASQLAGLGDGVPAVTMNDVCGSGLTSINLAAAMIQSGQADIMVAGGMESM
SNAPYVLDKARFGYRLGDGMMRDTILSDALTDAEGDFHMGITAENVAQKYDISREAMDAF
SLASHQKAAAAIERGDFDTEIVPVPVTVKRETTMITQDEGPRPDSSLEKLARLKPAFQED
GRVTAGNASGINDGAAAIVLVSEDALEQYGLTALAEWQGASLVGLDPTLMGVGPYYAVDK
LLGNADLTVDDINVFELNEAFAAQALASNQLLTVDEARVNPRGGAIALGHPVGASGARVL
VSLIHELQPEERGVAALCIGGGMGVSALITRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcgagtatttattgttggtgcgaaacgaacaccaatcggtaagtttggtggt
gcgttagcaagcaaaaccgctgctatgttgggtggattagcgattgaaggtgcgctaaac
caagcacaattacctactgaagcaaacgtggatcaagttttcatgggaaatgtgcttcaa
gccggttcaggacaaaatccagctcgtcaagccagtcaactagcaggtcttggggatggt
gtccctgcggttacgatgaatgatgtctgtggttctggattaacaagtattaatctagcc
gcagcaatgattcaatcaggtcaagcggatatcatggttgctggtggaatggaaagcatg
tcaaatgcgccatatgtgttagataaagcgcgttttggttaccgtctgggtgacgggatg
atgcgtgatacgattctatcagatgccttgactgatgctgaaggcgatttccatatgggg
attaccgctgaaaacgtggcgcaaaagtatgacattagccgtgaagcaatggacgcattt
agtctagctagtcaccaaaaagccgctgcggcaatcgaacgtggggattttgatacagaa
attgtgccagttcctgttacagtgaagcgtgaaacaacgatgattactcaggatgaaggg
cctcgaccagactcaagtttagaaaagctagcacgtctaaagcctgctttccaagaagat
ggtcgcgtcacagcggggaatgcatcagggattaacgatggtgccgctgcgattgtgttg
gtcagcgaagatgccctagaacaatatggactaacagccttggctgaatggcaaggcgca
agtctagttggattggatccaacattgatgggtgtcggaccttactacgcggttgataag
ttacttggtaatgctgacttaacggtagatgatatcaatgtctttgagttaaatgaagct
tttgcagcgcaagccttggcaagtaatcaattactaacagtagatgaagcgcgtgtgaac
ccacgtggtggagccattgctttgggacatcccgtaggtgcatctggtgcgcgtgtgctt
gtaagtttaattcatgagctacaaccggaagaacgtggagttgcggcactatgtatcggt
ggtggtatgggtgtatcagcattgattacacgtcgttaa

DBGET integrated database retrieval system