KEGG   Wolbachia wCle (Cimex lectularius): WCLE_009870Help
Entry
WCLE_009870       CDS       T03628                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
wcl  Wolbachia wCle (Cimex lectularius)
Pathway
wcl00970  Aminoacyl-tRNA biosynthesis
wcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WCLE_009870 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wcl03029]
    WCLE_009870 (gatA)
Enzymes [BR:wcl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     WCLE_009870 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     WCLE_009870 (gatA)
Mitochondrial biogenesis [BR:wcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    WCLE_009870 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase SWIRM-assoc_3 E2
Motif
Other DBs
NCBI-ProteinID: BAP00274
UniProt: A0A060PZR9
Position
959365..960828
Genome map
AA seq 487 aa AA seqDB search
MNELRKLSITEMHDGLKRKDFSAVELVEAHISAVENEKLNAFVTKTPEIAIKAAKAADEH
FSKQKSDMPLMGIPVGVKDLFCTKGIKTTACSKMLENFVPTYESTVSDLLLKSGAVMLGK
LNMDEFAMGSANTNSYFGSVENVWARKSDGEKVVPGGSSGGSAASVAGFLCAGALGSDTG
GSVRQPAAYCGVVGAKPTYGRCSRFGMIAFASSLDQAGVITRSVFDSALMLETICGYDSK
DSTSSKRPVPKFSNSINGNVKGKRIGIPKEYRMDGISEEIVHHWEKVSSNLKENGAEVID
ITLPHTKYAIPVYYLICSAEVSSNLARYDGVRYGFRADADTLEEMYSLTRAEGFGKEVKR
RILIGAYALFSGHYNEYYEKAQCIRALIRNDFIKAFEKIDYILVPSAPTEAFGLNEKPDP
LIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLALQVIGNYYDEAGILNVANVIEQNCG
RVIELHS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattaagaaagctgagcattacagagatgcacgatggacttaaacggaaagat
ttttctgctgttgaacttgttgaggcgcatatcagcgcggtagaaaacgagaaattaaat
gcatttgtgacgaaaactccagaaatagcaataaaagccgctaaagccgcagatgagcat
ttttcaaaacaaaaaagtgatatgccgctcatgggtataccagttggtgttaaagattta
ttctgcacaaagggaataaaaacaacggcatgctcaaaaatgctagaaaacttcgttccg
acttacgaatctacagtatctgacttgcttttaaaaagtggggcggtcatgctcggcaag
cttaacatggatgaatttgccatgggctctgcgaacacaaatagctatttcggttctgtt
gaaaatgtgtgggctagaaaaagtgatggggaaaaagttgtacctggtgggtcatctggt
ggatccgcagcatcggttgctggatttttatgcgctggagcgctcggaagtgacaccggt
ggatctgtgcgccagccagcagcttactgtggagtagttggagcaaagccaacttatgga
agatgttcgcgttttggtatgattgcatttgcaagttccctggaccaagcaggggtcatt
actcgttccgtttttgactcagcattaatgctggaaacgatttgtggctatgacagcaaa
gattcaacatcgagtaaaaggccagtgcctaaattttctaattctataaacggtaatgtc
aagggtaagcgcattggtataccgaaagaatatagaatggatggaatttcagaagaaatc
gtccatcattgggaaaaagtttcttccaatttgaaagaaaacggtgctgaagttattgat
attaccttgccacacactaaatatgcaataccagtctattatttaatttgttctgctgaa
gtttcatctaatcttgctcgttatgatggtgtgcgttatggattcagagctgatgctgat
accctcgaagaaatgtattcactaacaagagcagaaggttttggaaaagaggtaaaaaga
agaatcttaatcggtgcttatgcacttttttcaggtcactacaatgaatattacgaaaaa
gcacaatgtattagagcattaatcagaaatgattttataaaagcatttgaaaaaatagat
tacatactcgttccatctgctccaacagaagcttttggcttgaatgaaaagccagatccg
ctaattatgtgtatcaatgatgtcttcaccgtaccagcaagtttagctggactacctgct
atttctgttcctgttggactttccaatgaaggtttaccacttgctttacaagtaattgga
aactattacgatgaagctggaatattgaatgtagcaaatgtgatagagcaaaattgtggc
agagtgattgaactgcatagctag

DBGET integrated database retrieval system