KEGG   Weissella ceti WS74: WS74_0223Help
Entry
WS74_0223         CDS       T03280                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
wct  Weissella ceti WS74
Pathway
wct00450  Selenocompound metabolism
wct00970  Aminoacyl-tRNA biosynthesis
wct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wct00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WS74_0223
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    WS74_0223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:wct01007]
    WS74_0223
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:wct03016]
    WS74_0223
Enzymes [BR:wct01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     WS74_0223
Amino acid related enzymes [BR:wct01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   WS74_0223
Transfer RNA biogenesis [BR:wct03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    WS74_0223
 Prokaryotic type
   Other AARSs
    WS74_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF2833
Motif
Other DBs
NCBI-ProteinID: AIM62475
UniProt: A0A075U4U5
Position
263066..265054
Genome map
AA seq 662 aa AA seqDB search
MTENKTFYITTPIYYPSGKLHIGNTYTTVLADAEARYHRLLGEDVYFLTGTDEHGLKIEQ
KAEKLNMTPKAYVDGMAADIQKLWDYLDITNDGFIRTTDEQHEKAIQRIFKQFVDQGDIY
KGEYEGWYSVDDEEYFTESQLEEVYRDDAGKVIGGKAPSGHEVELVKEESYFFKMSKYAD
WLTEYYETHPDFVQPHSRMNEMMNNFIKPGLEDLAVTRTAFKWGVPVADDPKHVVYVWID
ALSNYITALGYGSDDDALFEKFWPANVQLVGKEIVRFHAIYWPIMLHALGLPLPEKLMAH
GWLTMRDGKMSKSKGNVVYPDTLADRYGVDAVRYYLLRAMPFGNDGIFTPEDFVSKLNYD
LANDLGNLLNRTVAMINKYEDGVIPALNTGKTEFDADLVRVANESIAAYNEHMEGVRTSD
ALAEVWKLISRANKYIDETTPWALAKDEEQAETLSSVMAHLAASLRVVAIMLQPVLTKAP
AKIFEQLGLAETNLQITGLKFEDLVSGGRVVAKGEPIFPRVDVEAEVKYIREEMTGTKPA
VETTEEVAEVEGKAMIEFDDFDKVEMRVGKIVDVSEVEKSSKLLRIKLDDGTENGRTILS
GIKKFYPEYAELVGKNIAFVANLKPRKMMGELSEGMILSAEKDGNVTLTFLPESIEAGSE
LG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaataaaacattctatatcactactcctatttactacccatcagggaagtta
catattgggaatacatacacaacggtgttggctgatgcggaagcgcgttaccaccgcttg
ttaggtgaagacgtgtacttcctaacaggaacagatgaacacggattgaagattgaacaa
aaagctgaaaagctaaacatgacgcctaaggcatacgttgatggtatggctgcggacatt
caaaagttgtgggattacttggacatcacaaatgatggcttcatccgtacaacagatgaa
caacacgaaaaggcaatccaacgtattttcaagcaattcgttgatcaaggtgacatctac
aagggtgaatatgaaggttggtattcagttgatgatgaagaatacttcacagaatcacaa
ctagaagaagtataccgcgatgatgctggtaaggttatcggtggtaaggcaccttctggt
cacgaagttgaattggtgaaggaagaatcttacttcttcaagatgagtaagtacgctgac
tggttgacagaatactacgaaacacaccctgatttcgtgcaaccacattcacgtatgaac
gaaatgatgaataacttcatcaagccaggactagaagacttggctgttacacgtactgcc
tttaagtggggagtacctgtcgcagatgatccaaagcacgttgtttatgtttggattgat
gcattgtcaaactacattactgcactaggatatggatcagatgacgatgcgttatttgaa
aagttctggccagctaatgtccaactagttggtaaggaaattgtacgtttccacgcgatt
tactggccaattatgttgcatgcattgggattgccattgccagaaaagttgatggcgcac
ggttggttgacaatgcgtgacggtaagatgtctaagtctaaggggaacgttgtttaccca
gatactttggctgaccgttacggtgttgacgctgtacgttactacttgttgcgtgcaatg
ccatttggtaacgacggaatcttcacaccggaagactttgtgtcaaagttgaactatgac
ttggccaacgatttgggaaacttgttgaaccgtacagttgcgatgattaacaagtacgaa
gatggtgttattccagcattgaacactggtaagacagaatttgatgcagacctagtacgt
gttgcaaatgaatcaattgcagcatacaacgaacacatggaaggcgtgcgtacatcagac
gcattggctgaagtatggaagttgatttcacgtgctaacaagtacatcgacgaaacaaca
ccatgggcacttgccaaggatgaagaacaagcagaaacattgagctcagtaatggctcac
ttggctgcctcacttcgtgtcgttgcgattatgttgcaaccagttttgactaaggctcca
gccaagatttttgaacaattaggattggcagaaacgaacttgcaaatcactggtttgaag
tttgaagacttagtttctggtggacgcgttgttgctaagggagaaccaatcttcccacgt
gtagacgttgaagctgaagtgaagtacattcgtgaagaaatgactggtacaaagccagcc
gtagaaacaacagaagaagtagcagaagtagaaggtaaagcaatgattgaatttgatgat
tttgacaaggttgaaatgcgtgttggaaagattgtagacgtctcagaagttgagaagtca
agcaagcttttgcgtatcaagctagacgatggtactgaaaatggacgtactattttgtca
ggaattaagaagttctatccagaatatgcagaacttgtggggaagaacatcgcattcgtt
gcgaacttgaagcctcgtaagatgatgggcgaactgtctgaaggtatgatcctatcagca
gaaaaggacggcaacgtaacgttgacattcttgccagaatctattgaagctggatctgaa
ttaggataa

DBGET integrated database retrieval system