KEGG   Weissella ceti WS74: WS74_0646Help
Entry
WS74_0646         CDS       T03280                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wct  Weissella ceti WS74
Pathway
wct00071  Fatty acid degradation
wct00072  Synthesis and degradation of ketone bodies
wct00280  Valine, leucine and isoleucine degradation
wct00362  Benzoate degradation
wct00620  Pyruvate metabolism
wct00630  Glyoxylate and dicarboxylate metabolism
wct00640  Propanoate metabolism
wct00650  Butanoate metabolism
wct00900  Terpenoid backbone biosynthesis
wct01100  Metabolic pathways
wct01110  Biosynthesis of secondary metabolites
wct01120  Microbial metabolism in diverse environments
wct01130  Biosynthesis of antibiotics
wct01200  Carbon metabolism
wct01212  Fatty acid metabolism
wct02020  Two-component system
Brite
KEGG Orthology (KO) [BR:wct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS74_0646
   00630 Glyoxylate and dicarboxylate metabolism
    WS74_0646
   00640 Propanoate metabolism
    WS74_0646
   00650 Butanoate metabolism
    WS74_0646
  Lipid metabolism
   00071 Fatty acid degradation
    WS74_0646
   00072 Synthesis and degradation of ketone bodies
    WS74_0646
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS74_0646
   00310 Lysine degradation
    WS74_0646
   00380 Tryptophan metabolism
    WS74_0646
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS74_0646
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS74_0646
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WS74_0646
Enzymes [BR:wct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WS74_0646
Exosome [BR:wct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS74_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIM62898
UniProt: A0A075U052
Position
complement(722958..724136)
Genome map
AA seq 392 aa AA seqDB search
MVKRVFIVGAKRTPIGKFGGALASKTAAMLGGLAIEGALNQAQLPTEANVDQVFMGNVLQ
AGSGQNPARQASQLAGLGDGVPAVTMNDVCGSGLTSINLAAAMIQSGQADIMVAGGMESM
SNAPYVLDKARFGYRLGDGMMRDTILSDALTDAEGDFHMGITAENVAQKYDISREAMDAF
SLASHQKAAAAIERGDFDTEIVPVPVTVKRETTMITQDEGPRPDSSLEKLARLKPAFQED
GRVTAGNASGINDGAAAIVLVSEDALEQYGLTALAEWQGASLVGLDPTLMGVGPYYAVDK
LLGNADLTVDDINVFELNEAFAAQALASNQLLTVDEARVNPRGGAIALGHPVGASGARVL
VSLIHELQPEERGVAALCIGGGMGVSALITRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcgagtatttattgttggtgcgaaacgaacaccaatcggtaagtttggtggt
gcgttagcaagcaaaaccgctgctatgttgggtggattagcgattgaaggtgcgctaaac
caagcacaattacctactgaagcaaacgtggatcaagttttcatgggaaatgtgcttcaa
gccggttcaggacaaaatccagctcgtcaagccagtcaactagcaggtcttggggatggt
gtccctgcggttacgatgaatgatgtctgtggttctggattaacaagtattaatctagcc
gcagcaatgattcaatcaggtcaagcggatatcatggttgctggtggaatggaaagcatg
tcaaatgcgccatatgtgttagataaagcgcgttttggttaccgtctgggtgacgggatg
atgcgtgatacgattctatcagatgccttgactgatgctgaaggcgatttccatatgggg
attaccgctgaaaacgtggcgcaaaagtatgacattagccgtgaagcaatggacgcattt
agtctagctagtcaccaaaaagccgctgcggcaatcgaacgtggggattttgatacagaa
attgtgccagttcctgttacagtgaagcgtgaaacaacgatgattactcaggatgaaggg
cctcgaccagactcaagtttagaaaagctagcacgtctaaagcctgctttccaagaagat
ggtcgcgtcacagcggggaatgcatcagggattaacgatggtgccgctgcgattgtgttg
gtcagcgaagatgccctagaacaatatggactaacagccttggctgaatggcaaggcgca
agtctagttggattggatccaacattgatgggtgtcggaccttactacgcggttgataag
ttacttggtaatgctgacttaacggtagatgatatcaatgtctttgagttaaatgaagct
tttgcagcgcaagccttggcaagtaatcaattactaacagtagatgaagcgcgtgtgaac
ccacgtggtggagccattgctttgggacatcccgtaggtgcatctggtgcgcgtgtgctt
gtaagtttaattcatgagctacaaccggaagaacgtggagttgcggcactatgtatcggt
ggtggtatgggtgtatcagcattgattacacgtcgttaa

DBGET integrated database retrieval system