KEGG   Weissella ceti WS74: WS74_0677Help
Entry
WS74_0677         CDS       T03280                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
wct  Weissella ceti WS74
Pathway
wct00670  One carbon pool by folate
wct01100  Metabolic pathways
wct01120  Microbial metabolism in diverse environments
wct01200  Carbon metabolism
Module
wct_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:wct00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    WS74_0677
Enzymes [BR:wct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     WS74_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA PHB_acc_N
Motif
Other DBs
NCBI-ProteinID: AIM62929
UniProt: A0A075TVM3
Position
complement(752193..753854)
Genome map
AA seq 553 aa AA seqDB search
MASDIEIAQAADVWPIEKIAEKVGLTPAEWEPYGRDKAKVEIDDSRDDDDLGKLVLVTSI
NPTPAGEGKSTVTVGLADALSLAGENTMIALREPSLGPVMGMKGGATGGGHSQVLPMADI
NLHFTGDFHALTSAHNTLAALIDNSIYQGNPLNIDPRRMIWKRALDVNDRALRNAVVGLG
GPTSGVPREDGFDIIVASELMAILTLSHNLMDMKARIERIVIGYTYDREPVTVKDLGVAG
ALTTLLKDAIKPNLVQTIAHTPTLIHGGPFANIAQGTNSIRATKTALQLADFVVTEAGFG
ADLGGEKFLDFKAPLLGKTPDTIVIVATVRALKMHGGMAKTELTEPNVAAVEAGLANLGQ
HLQSMSRYGVPVVVAINRFTTDTDAEIDRIKAFVADFGAQAYTADVWGQGGAGATELATA
VIEAANRPSNFTPLYDAEDDATVKLDKIVRTIYGAEGVELSDKATKQLRQFAQYGWDKLP
IIMAKTQYSLSDDATRLGAPKDFKIHVREFIPKVGAGFLVAMTGSILTMPGLPKTPAANN
IDIDASGHITGLF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgatattgaaattgcacaagcagcggacgtttggccaattgaaaagattgcg
gaaaaggttggattaacgccagcagaatgggaaccctatggtcgagataaggccaaggtt
gagattgacgattcacgtgacgatgatgatttaggaaaacttgtcctagtgacctcaatt
aatccaaccccagcgggtgaaggaaaatcaacggtaacggttggtttggccgatgcatta
tcattagccggtgaaaataccatgattgcattacgtgaaccgtcattaggaccagtcatg
gggatgaagggtggcgcgactggtggtggtcattcacaagtcttgccaatggctgacatc
aacttgcattttactggtgattttcatgccttaactagtgcccataatacattggcggcg
ctaattgataatagtatttaccaaggtaacccgttaaacattgatccacgtcgtatgatt
tggaagcgcgcattggatgttaatgatcgtgctttacgtaatgcggtggttgggttaggt
ggcccaacgagtggtgtcccacgtgaagatggttttgatattattgtggcgtctgaactc
atggccattttgactttgtcgcataacttaatggacatgaaggctcgcattgaacgcatc
gtgattggctacacctatgaccgtgaaccagtgaccgtcaaagacctaggtgttgcaggt
gcgttaacaaccttactaaaggatgcgattaagcctaatttggtccaaacaattgcgcac
acgccaactttgattcatggtggaccctttgccaacattgcgcaaggaacgaattcaatt
cgcgcaaccaaaacagcgttacaattggctgatttcgtggttacggaagcgggctttggg
gctgatttaggtggtgaaaagttccttgattttaaagccccattattagggaagacccct
gatacaattgtcattgtcgcaacagttcgtgcattaaagatgcatggtggtatggcaaag
acggaactaactgaaccaaatgttgccgcagttgaagccggtttggctaatttaggacaa
catttacaaagcatgtcacgttatggggtgcctgttgttgtggcgattaatcgtttcaca
acggatacagatgctgaaattgatcgtattaaagccttcgtagctgactttggtgcacaa
gcctacacagctgatgtatggggacaaggtggtgctggcgcaactgagttagccacggcc
gtgattgaagctgccaatcgtccaagtaactttacgcctctgtatgatgctgaggatgat
gcaaccgtcaaattggataagattgtgcgcaccatttatggagctgaaggggttgaatta
tccgataaagcaaccaaacaattgcgtcaatttgcccaatacggttgggacaaactacca
atcattatggcgaagacacagtattcattgtcagatgatgcgacacgattaggcgcgcca
aaagactttaagattcatgttcgtgaatttattccaaaggttggggctggtttcttagtc
gcaatgacgggatcaattttgacgatgcctggtttaccgaaaacaccggccgcgaacaac
attgatattgatgccagtggccatattactggtttattctaa

DBGET integrated database retrieval system