KEGG   Wolbachia wNo (Drosophila simulans): wNo_02520Help
Entry
wNo_02520         CDS       T02641                                 

Definition
(GenBank) Isocitrate dehydrogenase, NAD-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
wed  Wolbachia wNo (Drosophila simulans)
Pathway
wed00020  Citrate cycle (TCA cycle)
wed00480  Glutathione metabolism
wed01100  Metabolic pathways
wed01110  Biosynthesis of secondary metabolites
wed01120  Microbial metabolism in diverse environments
wed01200  Carbon metabolism
wed01210  2-Oxocarboxylic acid metabolism
wed01230  Biosynthesis of amino acids
Module
wed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wed_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:wed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wNo_02520
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    wNo_02520
Enzymes [BR:wed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     wNo_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh TT1725
Motif
Other DBs
NCBI-ProteinID: AGJ98686
UniProt: M9WNK2
Position
complement(287578..289005)
Genome map
AA seq 475 aa AA seqDB search
MSTSVTVAYGDGIGPGIMEAVLSILREAKAEISIDIIEIGERVYSKEWSHGISPSGWESI
ERTKVLLKSPTTTPQGKGHKSLNVALRKNLGLYANIRPCISYHPVIENKFDKFDVVVIRE
NEEDVYTGIEHRLTGDSYQCTKIITRSGSEKICRYAFEYAQKHNRKKVTCLTKDNIMKMT
DGTFHAAFDRVAKEYPDIKADHYIVDIGMAKVATEPENFDVIVTENLYGDILSDIVAQTS
GSVGLAGSSNIGNEYAMFEAVHGSAPDIEGKNIANPSGLLNAAVHMLIYIDQATTAKLIY
DAWLKTLEDGVHTADLYKEKKSKQKVGTKEFAEAIINNLGKKPGILSELIIDNSASNKTS
KIQDSYEQDYKTKKLVGSDITLAWNKSGNFNQIVELFKSSDPKIIAIYSKGLAIWPGKSE
SSSDQITCRFIADNEKKAITNSDVNNLLTKLEENNFDVVRMDKLYLYDGKEGFFS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcagtcacagttgcgtatggtgatggtatcggaccaggaattatggaagcg
gtgctgtcgatattgcgtgaagcgaaagcagagatctcaatagatattattgaaatagga
gagcgtgtttatagtaaggaatggtctcatggaatttctccgagtggttgggagtctatt
gaaaggacaaaagtgttacttaaatctccaacaacaactccgcaaggcaaagggcacaaa
agcttgaacgttgcactgcggaagaatttagggctgtatgcaaacatcagaccatgcatt
tcgtatcaccctgttatagaaaataaattcgataaatttgatgttgttgtaatacgtgaa
aatgaagaagacgtttatacgggaatagagcataggctcactggtgactcgtaccaatgc
actaaaattattactagatccggttcagagaaaatatgcagatacgcttttgaatatgcg
caaaaacacaatagaaagaaagtaacttgcctgactaaagataacataatgaaaatgact
gacggcacttttcatgcagcatttgatcgtgttgcaaaagaatacccagatataaaggca
gatcattatatagttgatattggaatggcaaaagttgccacagagcccgagaattttgat
gttatagtaactgagaatttatatggtgacatattatcagatatagtcgcacaaacctct
ggatctgtaggacttgctggaagtagcaacataggtaatgaatatgcgatgttcgaagca
gtgcatggttctgctcctgatattgaaggaaaaaatatagctaatccttctggtctttta
aatgctgcagtgcatatgctaatttacatagatcaagctactactgcaaaactaatttat
gatgcgtggctcaagactttggaagatggagtacacactgctgatttatataaggagaaa
aaaagtaaacagaaagtgggtacaaaagaatttgcagaagctattataaataatctagga
aagaaaccaggaatactatctgaacttataattgacaatagtgcaagtaataaaacaagt
aaaatacaagatagctatgaacaggactataaaactaaaaagctagttggtagcgacata
acgcttgcttggaacaaatctggcaattttaaccaaatagtagaattatttaaatcaagt
gatcctaagattatagcgatatactcaaaaggtcttgcaatctggccaggaaagtcagaa
tcttcaagcgatcaaataacctgcaggtttattgcagataatgaaaagaaagctatcaca
aacagtgacgtgaataacttactaacaaaactcgaagaaaataactttgatgtagtgaga
atggacaaattgtatttatacgatgggaaagagggttttttctcttaa

DBGET integrated database retrieval system