KEGG   Wolbachia wHa (Drosophila simulans): wHa_02790Help
Entry
wHa_02790         CDS       T02640                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
wen  Wolbachia wHa (Drosophila simulans)
Pathway
wen00970  Aminoacyl-tRNA biosynthesis
wen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wen00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    wHa_02790 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:wen03029]
    wHa_02790 (gatA)
Enzymes [BR:wen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     wHa_02790 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     wHa_02790 (gatA)
Mitochondrial biogenesis [BR:wen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    wHa_02790 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase SWIRM-assoc_3
Motif
Other DBs
NCBI-ProteinID: AGJ99751
UniProt: M9WRF2
Position
complement(335006..336475)
Genome map
AA seq 489 aa AA seqDB search
MNELRKLSITQMHDGLKKKSFSAVELVEAHISAVENEKLNAFITKTPEIAMKAAKAADEY
FSRQKDDLISPLMGVPVGIKDLFCTKGIKTTACSKMLENFVPTYESTVSDLLLKSGAAML
GKLNMDEFAMGSANTNSYFGPVENVWIRKSDGEKVVPGGSSGGSAASVAGFLCAGALGSD
TGGSVRQPAAYCGVVGIKPTYGRCSRFGMIAFASSLDQAGVITRSVSDSALMLEAICGYD
TKDSISSRKPAPKFSSFINGDVKGKRIGIPKEYRMDGISEEIVHNWEKVASYLKENGAEV
VDVTLPHTKYAIPVYYLICSAETSSNLARYDGVRYGFRVDADTLEEMYSLTRAEGFGKEV
KRRILIGAYALSSGHHNEYYEKAQCIRALIRNDFIKAFEKIDYILVPSAPTEAFGLNEKP
DPLIMCINDVFTVPASLAGLPAISVPVGLSNEGLPLALQVIGNYYDEAGILNVASVIEQN
CGRIIRPLA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactaagaaagttaagtattacacaaatgcatgacgggctcaaaaaaaagagt
ttttctgccgttgaactcgtagaggcgcacatcagtgcggttgaaaatgagaaattaaat
gcatttataacaaaaaccccagagatagcaatgaaagctgctaaagctgcagatgaatat
ttctctaggcaaaaggatgatttaatctcgccgctcatgggtgtaccagttggcatcaaa
gatctattctgtacaaaaggaataaaaacaacagcatgctcaaaaatgctggaaaatttc
gttccgacttacgaatctacggtgtctgacttgcttttaaaaagtggagcagccatgctc
ggtaagcttaatatggatgaatttgctatgggttctgcgaacacaaacagctattttggc
cctgtcgaaaatgtgtggattagaaaaagtgatggggaaaaagttgttcctggtggatca
tctggtggatctgcagcatcggtggctggatttttatgcgctggagcactagggagtgac
accggtggatctgtacgccaaccagcagcttactgtggagtagttggaataaagccaact
tatggaagatgctcgcgttttggtatgattgcatttgcaagttctctagatcaagcagga
gtcattactcgttctgtctctgattcagcattaatgctggaagcaatctgtggctatgat
acaaaagattcaatatcaagtagaaagccagcacctaaattttccagctttataaatggt
gatgttaagggtaagcgtattggtataccaaaagaatataggatggatggaatttcagag
gaaatagtccataattgggagaaagttgcttcctatttaaaagaaaatggcgctgaagtt
gttgacgttactctgccacatactaaatatgcaataccagtctattatttaatttgttct
gctgaaacttcatccaatcttgctcgttatgacggtgtgcgttatgggttcagggttgat
gctgatacccttgaagaaatgtattcactaacaagagcagaaggtttcggtaaagaggtg
aaaagaagaattttaattggcgcttatgcgctttcttcaggtcatcataatgaatattac
gaaaaagcgcagtgcattagggcattaatcagaaatgattttataaaagcgtttgaaaaa
atagattacatacttgtgccatctgctccaacagaagcttttggcttaaatgaaaagcca
gatccgctaattatgtgcatcaatgatgtgtttactgtgccggcaagtctggcaggattg
cctgctatttctgttcctgttgggctctccaatgagggtttaccacttgccttgcaagtg
attggaaattattatgatgaagctggaatattaaatgtggcaagtgtgatagagcaaaat
tgcggcagaataattagacctcttgcataa

DBGET integrated database retrieval system