KEGG   Wolbachia wHa (Drosophila simulans): wHa_05740Help
Entry
wHa_05740         CDS       T02640                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
wen  Wolbachia wHa (Drosophila simulans)
Pathway
wen03010  Ribosome
Brite
KEGG Orthology (KO) [BR:wen00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    wHa_05740 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:wen03011]
    wHa_05740 (rplV)
Ribosome [BR:wen03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    wHa_05740 (rplV)
  Bacteria
    wHa_05740 (rplV)
  Archaea
    wHa_05740 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGK00021
UniProt: M9WUJ3
Position
complement(688392..688739)
Genome map
AA seq 115 aa AA seqDB search
MKNRDVIVKAGSRVLKSTPRKLNLVAGLVRNKKVSFATVQLRFCEKKAAGLIRKVLNSAI
ANAQNYGLDIDNLYIKEILIGKSLTLRRVCPKAMGRANRVSKRYSNITVKLGEII
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagagatgtaatagttaaagctggttctagggttttaaaatcaactcctcgt
aaattgaatttggttgctggtttagtacgtaataaaaaagtttcttttgccactgtgcaa
ttaagattttgtgaaaagaaagctgcaggtcttataaggaaggtattaaattctgcgatt
gctaatgctcaaaattatggattggatatcgataatttatatataaaagaaattttaata
ggtaagtctcttactttgcgtagggtatgtccaaaagctatgggtagagctaatagagtt
agtaaacgttatagtaatataactgtaaaattgggggaaattatatga

DBGET integrated database retrieval system