KEGG   Wolbachia wFol (Folsomia candida): ASM33_00725Help
Entry
ASM33_00725       CDS       T05726                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
weo  Wolbachia wFol (Folsomia candida)
Pathway
weo00260  Glycine, serine and threonine metabolism
weo01100  Metabolic pathways
weo01110  Biosynthesis of secondary metabolites
weo01120  Microbial metabolism in diverse environments
weo01130  Biosynthesis of antibiotics
weo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:weo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASM33_00725
Enzymes [BR:weo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ASM33_00725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APR97857
UniProt: A0A218KME3
Position
352384..353427
Genome map
AA seq 347 aa AA seqDB search
MKIRIDFFSDSNTNPSIEMREVMAKAEVGNEAACEDPTVNELIEATCKTLGKPAGIFLIS
GTMCNVIAYKVHIQRPGDYLILDETSHPLIVQSGLIAAQAHATPLPIKGTRGIFTEDQIM
DFIIRPSLRNVPKVGLVSIEQTTNFGGGAVWPLKYIQEISSLCKKNNVLTHLDGARLFNA
CTHTKIPPKEYASYFDSVFIDFSKGLGAPMGAVLAGSKEFIEKAWYYKFQIGGAIHQAGI
ISAACLYALYNNINSLEEDHKKMQHLIESLSSIDQVIIDTDIYKTNIAYFSLRADSMSIQ
KLIDTLMTNYGIRMANIRGKIRVITHRDISYEDINTTASTIRKILSE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaatagatttctttagtgattcaaatactaatccttcaattgagatgagg
gaagtaatggctaaagcagaagttggaaatgaagctgcatgtgaagatccgacagtaaat
gaattaatagaagccacatgtaaaacactaggtaagccagcaggaatatttttgatttca
gggacgatgtgtaatgtgattgcttataaagtacatattcaaagaccaggtgattatctt
atacttgatgagacttcacatccattaatagtgcaatctggattaattgcagcccaggca
catgcaactcctttacctattaaaggaacgagaggaatatttactgaagaccaaattatg
gactttattattcgtcctagcttaagaaatgtcccaaaagttgggttagtatccattgaa
cagacaacaaattttggtggtggggctgtatggcctctaaagtacattcaagaaatttca
agtctatgtaaaaaaaataacgtgcttactcatttagatggtgcaagattatttaatgct
tgtactcatactaaaattcctccgaaagagtatgcaagttactttgactctgtatttatt
gattttagcaaaggattaggtgcccctatgggagcagtgttagctggaagcaaagaattc
atagaaaaagcttggtactataaatttcaaattggtggagctatacatcaagctggcatt
atttctgctgcatgcttatatgctttatataataatataaattccttagaagaagatcat
aaaaaaatgcaacacctcatagaaagcctgagttctatagatcaagttataatcgatact
gacatttataagactaatatagcgtatttctcattacgtgctgattctatgtctattcag
aaattaatagatacactaatgactaattatggaattagaatggccaacataagaggtaag
atcagagttataacgcatagagatataagctatgaggatattaatacaactgcatctact
ataaggaaaatactaagtgaataa

DBGET integrated database retrieval system