KEGG   Wenyingzhuangia fucanilytica: AXE80_01640Help
Entry
AXE80_01640       CDS       T04444                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
wfu  Wenyingzhuangia fucanilytica
Pathway
wfu00620  Pyruvate metabolism
wfu00630  Glyoxylate and dicarboxylate metabolism
wfu01100  Metabolic pathways
wfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXE80_01640
   00630 Glyoxylate and dicarboxylate metabolism
    AXE80_01640
Enzymes [BR:wfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AXE80_01640
    1.2.1.22  lactaldehyde dehydrogenase
     AXE80_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANW95076
UniProt: A0A1B1Y2S4
Position
380549..382003
Genome map
AA seq 484 aa AA seqDB search
MSQIKEYKLFINGEWKTSTSGETIDIINPSTEEVTARVQNGTAEEALEALEAADKAQKEW
KKLPARQRAELLYKLADEIDANTEYLAELLTKEQGKLLKVARFEVAVTASFIRYACEGAR
RIEGDIIPSDNHNEQIWIQKVPRGVIVAITAWNFPLALAGRKLGPALVAGNTIVIKPTSE
TPLATLELGNLANKVGIPAGVINILTGPGRAMGNALVESPITKMVTMTGSTPVGQQIARN
AATNLTHVQLELGGKAPFIVFEDADIDAAVAAALHSRFDNCGQVCTCNERMYVHEGIYDV
FMEKFIKATKALKVGDPMLEETDMGPKVNAAELKHMEELVAISVKEGATVATGGKRPEGA
EFDKGYWFEPTVLTNVTQDMTIVHEESFGPILPVLKFSSFDEVIGYANDCEYGLAAMVFT
NDMNTIMKCNDELEFGEIYVNRGHGEQHQGFHNGYKLSGSGGEDGKYGFEQYLEKKTFYI
KHKV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaataaaagaatataagctgttcattaacggcgaatggaaaacatcaacttca
ggtgaaactatagatattataaatccatctacagaagaagtaacagctagagtacaaaat
ggtactgcagaagaagctttagaagcattagaagcagctgataaagctcaaaaagaatgg
aaaaaattacctgctcgtcagcgcgctgaattactgtataaattagcggatgaaatagat
gctaataccgaatatttagcagaattattaactaaggagcaaggaaaacttttaaaagta
gcacgttttgaagttgctgttaccgcatcatttattagatatgcttgcgagggagctcgt
agaatagaaggagatattattccttctgacaatcataatgaacaaatttggattcaaaaa
gtacctcgtggggtaattgttgccattactgcgtggaactttccattggctttggcaggt
cgtaaattaggaccagcattggttgcaggtaacactattgtaattaaacctacatcagaa
acgccattggcaactttagagttaggaaacttggcaaacaaagttggaattccagctggg
gtaatcaatattttaacagggccaggtagagcaatggggaatgcattggtagaaagccct
attactaaaatggtaacaatgactggttctacacctgtaggacagcaaattgcacgtaat
gcagcaacaaacttaacgcatgtacaattagaactaggaggtaaagcaccatttattgtt
tttgaagatgcagacattgatgcagcagtagcagcagctttacattctcgttttgacaac
tgtgggcaggtttgtacttgtaatgaacgtatgtatgtacacgaaggaatttacgatgtg
tttatggagaaattcatcaaagctacaaaagcattaaaagttggagatccaatgttagaa
gaaacagacatggggcctaaagtaaatgctgctgaattaaaacacatggaagaattagtt
gccattagtgttaaagaaggagcaacagttgcaactggaggtaaaagaccagaaggagct
gagtttgataaaggttattggtttgagccaacagttttaaccaatgtaactcaagacatg
actattgtacacgaagaatcttttgggcctattttgcctgttttaaagtttagttctttt
gatgaggtaattgggtatgcaaatgattgtgagtacggattggctgctatggtgtttacg
aatgatatgaacactattatgaaatgtaatgatgaattggagtttggagaaatatatgta
aacagaggtcatggtgagcaacaccaaggattccataatggatacaaattgtctggttct
ggaggagaagatggaaaatatggatttgaacaatatttagaaaagaaaactttctacatc
aaacataaagtctaa

DBGET integrated database retrieval system