KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0468Help
Entry
WIGMOR_0468       CDS       T01747                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00010  Glycolysis / Gluconeogenesis
wgl00030  Pentose phosphate pathway
wgl00051  Fructose and mannose metabolism
wgl00680  Methane metabolism
wgl01100  Metabolic pathways
wgl01110  Biosynthesis of secondary metabolites
wgl01120  Microbial metabolism in diverse environments
wgl01130  Biosynthesis of antibiotics
wgl01200  Carbon metabolism
wgl01230  Biosynthesis of amino acids
Module
wgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0468 (fbaA)
   00030 Pentose phosphate pathway
    WIGMOR_0468 (fbaA)
   00051 Fructose and mannose metabolism
    WIGMOR_0468 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    WIGMOR_0468 (fbaA)
Enzymes [BR:wgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     WIGMOR_0468 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: AFA41294
UniProt: H6Q511
Position
complement(478442..479512)
Genome map
AA seq 356 aa AA seqDB search
MPNILKLIGSGVIFGDKIKQLFTIAKTQGFAIPAINCIGTDSINASLEVASKLRSPVIIQ
FSYSGASFIAGKQMNSKQGSILGAISGALHVHNIAKHYNIPVILHTDHCSKAMLPWIDSL
IIAGEKNFKNTGKPLFSSHMIDLSLEPLKENIKISSQYLKKMRELNMMLEIELGCTGGEE
DGINNQNLHHSKLYTKPEDVKYAYENLKKIGSNFIIAASFGNCHGVYRFGNIKLKPKILK
LSQQYVSKKFGLNKYPLNFVFHGGSGSSIADIQLAIKYGVVKINIDTDTQWATWKGILNF
YKKNKNYLQSQLGNPEGKDCPNKKFYDPRNWLRCAQISMIKKLEKIFYQLNVVNVL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattttaaaattaattggatccggagtaatattcggagataaaataaaacaa
ctattcactattgcaaaaacacaaggttttgctatacctgcaataaactgtatcgggaca
gattcaattaatgcatccttagaagttgcttctaaattacgttctcccgtgattattcaa
ttttcttatagtggagcatcttttattgcaggaaaacaaatgaattctaaacaaggatca
atattaggcgcaatatcaggagcattgcatgtacataatattgcaaaacattataatatt
ccagtaatattgcatacagatcattgttctaaagcaatgttaccgtggatagattctcta
ataatagcaggagaaaaaaattttaaaaataccggaaaacctttattttcatcacatatg
atcgatttatctttggaacctttaaaagaaaatattaaaattagcagtcaatatttaaaa
aaaatgcgtgaattaaatatgatgcttgaaattgaattaggatgtacaggaggagaagaa
gatggaataaacaatcaaaatttacatcattccaagttatatactaaacccgaagatgta
aaatacgcgtatgaaaatttaaaaaaaattggatctaattttattattgctgcatctttt
ggcaattgtcacggagtatatcgttttggaaatattaaattaaaaccaaagattttaaaa
ttatctcaacaatatgtttctaaaaaatttggtttaaataaatatccgttgaattttgta
tttcatggtggatcaggatcaagtattgcagatattcaacttgcaattaaatatggagta
gtaaaaataaatatcgatacagatactcaatgggctacttggaaaggaatattaaacttt
tacaaaaaaaataaaaattatttacaatcccaactcggtaatccagaagggaaagattgt
ccaaacaaaaaattttatgatcctagaaattggctaagatgtgcacaaatttctatgatt
aaaaaattagaaaaaatattttatcaactcaacgtagtaaatgtattataa

DBGET integrated database retrieval system