KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0513Help
Entry
WIGMOR_0513       CDS       T01747                                 

Definition
(GenBank) exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:wgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    WIGMOR_0513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:wgl03400]
    WIGMOR_0513
Enzymes [BR:wgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     WIGMOR_0513
DNA repair and recombination proteins [BR:wgl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     WIGMOR_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AFA41333
UniProt: H6Q550
Position
complement(530384..533683)
Genome map
AA seq 1099 aa AA seqDB search
MIYTYYSNDLEILKSILSSFMKRFPIRNAMCNEIIIVNHQSMMKWLKIKLAYDIDIVLNI
DFLLVNNFIWNILKINIKNLPHDHFSFKTMLMWYIVRIILNIKNFEKYSELNQLLKINNQ
YQIFYFANKLSDLYFQYLIFRPDWISLWEQNKLIKNIGKEQIWQSVIWKKLVKKIKKEKN
FNISNIYQMCVEMIKKSLNLPQNHPKRIFLFNVSFMPPIYLRILEQISMHLEVHLFFVNP
SYKYWSDIQNQNCFSYFPKSYTKKINKSLKKISVKYSLLASWGKSGSDYLLLLENLDYII
NIEAFYKRKNNTLLNYLKNDILKHRYYSNIQSNSLISDSMRYLDVKDNSIYICECNSIYN
EIELLYIYLLDILSRNHHISPRDIIVMSIDIEKYAQAIQSVFNKNLYNIHANISDRKILK
LHPILSNIFNLLKLPKYTFSVEQIFSFLECSAIANRYRINSNELKILKNLITHTEIRWGL
NSKIFQKNHPNCISKHTWTENIKQILYEYAMTKKENKYEFFFKQKYNKINIFHAVGKLSE
IIDQITIWYEKLSCSRELHLWKDCINEIICDFFQPNKEEKKVLKILKKNWSKIILNGEYS
KYNKLINIEVLSQILFKNIDQEKYSQKFLSGNIDFCNFSASKTFPYKVICLLGMNDNVYP
KSNIHIDFDLMYQSPRFGDQNCYDEDRYAFLKILLSAKNNLYISFLKNSIQADKLQYSSV
IINELLEYIAVSFRFPNKNITSFLENFFLVKDFLIKKNINQSSLSCILNIQNYHQNLLKN
NQDIKKNSCTLTFRNKKNKYIFQILINKFLEFYTHPIRFWCKYYLNINFSNSLNYLHNKK
NNFNFQLIKNCININLFRYFMQNYPKMKIKNIFYEIKNIPYGKIGMIIAEQQCDKILKLV
NMINKYKCTTINKIKVCFECGDVKIMGFLFNISKSGLLRWNIRKLSLYDGLLFWIEHLLY
CISGGIGDSYFFGIESHWHYTHISQKKAKELLYIFIIGYQQGTNFPLTLLNKCGSEWIIN
CFNKNKKILNLDKKSQNYACTKLINAWNGNMFISGESKDPYICKVIPCLTKFYIDKIIKE
SKKYLIFPLKFHCSKQDFY
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacatattactctaatgatttagaaattttaaaaagtattttatcgtctttt
atgaaaagatttcctatacgaaatgctatgtgcaacgaaattattattgttaatcatcaa
tcaatgatgaaatggttaaaaataaaacttgcatatgacatagatatagttttaaacata
gattttttgttggttaataattttatttggaatatattaaaaataaatataaaaaatctt
cctcatgatcatttttcttttaaaacaatgcttatgtggtatattgtacgtataatattg
aatattaaaaattttgaaaaatattcagaattaaatcaattattaaaaattaataatcag
tatcaaattttttattttgctaacaaactatctgatttgtattttcaataccttattttt
cgtcctgattggatatctttatgggaacaaaataaattaattaaaaatataggaaaagag
caaatttggcaatctgttatatggaaaaagttagtaaaaaaaataaaaaaagaaaaaaat
tttaatatttctaatatatatcagatgtgcgttgaaatgattaaaaaaagtttaaattta
cctcaaaaccatccaaaaagaattttcttattcaatgtttcatttatgcctccaatatat
ttaagaattttagaacaaatcagtatgcatcttgaagtacatttattttttgtgaatcct
tcctataagtactggagtgatattcaaaatcaaaattgtttttcatattttcctaaatca
tatacaaaaaaaataaataaatcacttaaaaaaatttctgttaaatattctttattagct
tcttggggcaaatcagggtctgattatttacttttactagaaaatttggattatatcata
aatatagaagctttttataaaagaaaaaataatacattattaaattatttaaaaaatgat
atattaaaacatcgatattattctaatattcaatcaaatagcttaatttcagatagtatg
cgttatttagatgttaaagataattcgatatatatttgcgaatgcaatagtatatacaat
gaaatcgagttattatatatatatcttcttgacattctttcaaggaatcaccatatctcg
cctcgagatattatcgtaatgtctatagacatagaaaaatatgctcaagcaattcaatca
gtatttaacaaaaatttatataatatacatgcaaatatttcagatagaaaaatattaaaa
ttacatcctattttatcaaatatttttaatcttttaaaactacctaaatatacattttct
gtggaacaaattttttcttttttagaatgttcagcaattgcaaatcgatatagaataaat
tcgaatgaacttaaaatattaaaaaatttaattactcatacggaaattcgttggggattg
aacagtaaaattttccaaaaaaatcacccaaattgtatttctaaacatacttggacagag
aatattaaacaaatattatacgaatatgctatgacaaaaaaagaaaacaaatatgaattt
tttttcaaacaaaaatataataaaattaatatttttcatgcagtaggaaaattatcagaa
attattgatcaaattaccatatggtacgaaaaattatcttgttcgcgcgaattgcattta
tggaaagattgtataaatgaaataatctgtgattttttccaacctaataaagaagaaaaa
aaagtactaaaaatattaaaaaaaaattggagcaaaattattctcaacggagaatattca
aaatacaacaaattaattaatatcgaggtactatcacaaattttatttaaaaatattgat
caagaaaaatatagtcaaaaatttttatctggaaacattgatttttgcaatttttctgct
tcaaaaacatttccatataaagtaatttgtttactaggcatgaacgataatgtatatcct
aaatctaatattcatatcgattttgatttgatgtatcaatcaccgcgatttggagatcaa
aattgttatgatgaagatcgatatgcatttttaaaaatattattatctgcgaaaaataat
ttatatattagttttttgaaaaattcaatacaagcagataaattgcaatattcttctgtt
attattaatgaattactagaatatattgcagttagttttcgatttccaaataaaaatata
actagttttttagaaaatttttttttagtaaaagactttttaataaaaaaaaatatcaat
caatcaagtttatcttgcatattaaatattcagaattatcatcaaaatttattaaaaaat
aaccaagatataaaaaaaaattcttgcacgttaacttttagaaataaaaaaaataaatat
atttttcagatattaataaacaaatttttagaattttatacacatccaatacgtttttgg
tgtaaatattacttaaatataaatttttcaaatagtttgaattatttgcataataaaaaa
aacaacttcaattttcaattaataaaaaattgtattaacattaatttatttcggtatttt
atgcaaaactatccaaaaatgaagataaaaaatattttttatgaaataaaaaatattcct
tacggaaaaattggaatgattatcgcagaacaacaatgtgataaaatattaaagttagtt
aatatgattaataaatataaatgtactacaattaataagattaaagtatgttttgaatgc
ggggatgtgaaaataatgggttttttatttaatatttctaaatctggattattacgctgg
aacatacgtaagttatctttatatgatggtttattattttggatagaacatttgctgtat
tgcatttcaggaggaataggtgatagttatttttttggtatagaatcacattggcattat
acacatatatcacaaaaaaaagcaaaagaactattatatatttttataatcggttatcaa
caaggcacaaactttccactaactttattaaataaatgtggtagtgaatggataataaat
tgttttaataaaaataaaaaaatattaaatttagataaaaaatctcaaaattatgcgtgt
acgaaattaattaatgcttggaatggtaatatgtttatttctggagaatcaaaagatcca
tatatatgtaaagtaataccttgcctgacaaaattttatattgataaaattatcaaagaa
tcaaaaaaatatttaatttttccattaaaatttcactgttctaaacaagatttttattaa

DBGET integrated database retrieval system