KEGG   Wigglesworthia glossinidia morsitans (Glossina morsitans): WIGMOR_0568Help
Entry
WIGMOR_0568       CDS       T01747                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
wgl  Wigglesworthia glossinidia morsitans (Glossina morsitans)
Pathway
wgl00010  Glycolysis / Gluconeogenesis
wgl00260  Glycine, serine and threonine metabolism
wgl00680  Methane metabolism
wgl01100  Metabolic pathways
wgl01110  Biosynthesis of secondary metabolites
wgl01120  Microbial metabolism in diverse environments
wgl01130  Biosynthesis of antibiotics
wgl01200  Carbon metabolism
wgl01230  Biosynthesis of amino acids
Module
wgl_M00002  Glycolysis, core module involving three-carbon compounds
wgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:wgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WIGMOR_0568 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    WIGMOR_0568 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WIGMOR_0568 (gpmA)
Enzymes [BR:wgl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WIGMOR_0568 (gpmA)
Membrane trafficking [BR:wgl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    WIGMOR_0568 (gpmA)
Exosome [BR:wgl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WIGMOR_0568 (gpmA)
  Exosomal proteins of melanoma cells
   WIGMOR_0568 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFA41382
UniProt: H6Q599
Position
complement(587846..588544)
Genome map
AA seq 232 aa AA seqDB search
MSIIKLVLMRHGRSIWNDQDRFTGWTDIELSEKGEKEVKYAGEVLRSFGYLFDFAYTSLL
KRAIHSLWILLQEIDQSWIPIEKSWRLNERHYGALQGFSKNEIKTKYGSAQLKEWRRGFL
SIPPKLNTNDIRFPGNDPRYLRLKLSGQLPTTESLKSTIDRIIPYWKKKIFPKLKNKNKL
IIVAHGNSIRAIMKLLDNLDEKQITQLNVPTGVPLIYEFDKNVCPKKHYFLF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctataattaaattggttttgatgcgtcatggaagaagtatatggaacgatcaagat
cgttttactggatggacagatattgaattatctgaaaaaggcgaaaaagaagtaaaatat
gcaggagaagtattaagatcttttgggtatttatttgattttgcttatacatctttatta
aaaagagctattcatagtttatggattcttttacaagaaatagatcaatcttggattcca
atagaaaaatcttggagattaaacgaaagacattacggagctttacaaggatttagcaaa
aatgaaattaaaacaaaatatggcagtgcacaattaaaagaatggcgtcgtggattttta
agtatccctccgaaattaaacacaaatgacatacgatttccaggaaatgatccgcgatat
cttcgtttaaaactttctggtcaacttcctactacagaaagcttaaaatctacaattgat
cgtattataccgtattggaaaaaaaaaattttccccaaattaaaaaataagaataaatta
attattgttgcacatggaaattctattcgagcaattatgaaattattagataatcttgac
gaaaaacaaataacccagttaaatgtgcccactggagtaccattaatatacgaatttgat
aaaaatgtatgtcctaaaaagcactattttttgttttaa

DBGET integrated database retrieval system