KEGG   Wallemia ichthyophaga: J056_000377
Entry
J056_000377       CDS       T03457                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00100  Steroid biosynthesis
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    J056_000377
Enzymes [BR:wic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     J056_000377
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 20373329
NCBI-ProteinID: XP_009266050
UniProt: R9AWY9
Position
Unknown
AA seq 426 aa
MTKELNPKTKEYSFFGPIGTGAITILTPVITYLLYYACPNSYDDGTCKLLQKPALGRLAG
SDFWYSLFTLEAFAVYLAWYAFTVFAWAIIPAQWVRGTQLRDGSYKYYKMNALATLLMAT
GLAAGQILRAGPEGFTYFADNWIPLLTASLVMSIAQSVFCYVSSFTQGKLLALGGNTGNC
VHDFFIGRELNPSIGSFDIKTFNELRPGLILWWILDISLACRQLATFGQLTDSMILVVAF
HGWYVFDALYNESIILTQMDIVHDGFGYMLAFGDLTWVPFTYSLQARFLAYHPNILGPSG
SAAIAALQLLGYYIFRTSNAEKNEFRNGKNPKNLQYMQTKRGTKLLTSGWWGTLRHPNYL
GDLIMALAWSLPTGSLTPLTYFYPAYFTVLLIHRALRDDAHCREKYGDDWNAYVEKVPYC
IFPYVF
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgacaaaagaattgaatccaaagacaaaggagtacagcttctttggtccgattggtact
ggcgcgataacgattctcacgccagttatcacctacttgctctactacgcctgtccaaac
tcgtatgatgatggtacgtgcaagctactccagaaaccagcgcttggtagactggctgga
agcgatttctggtattctctcttcacgcttgaggcttttgctgtatatctcgcttggtac
gctttcactgtcttcgcatgggctattatacctgcacaatgggtacgcggtacacagctg
cgtgatggatcgtacaagtactacaagatgaatgcgctagccactcttctcatggctact
ggtttggctgctggacagattctgcgcgcaggtccagaaggattcacgtattttgccgat
aattggatacctctgctcactgcatccctcgtcatgtctatcgctcagtctgtgttctgc
tacgtgtcctcctttacgcaaggaaaactacttgctttgggcggcaacacgggcaactgt
gtgcatgatttcttcatcggtcgcgaattaaacccttcgattggatcattcgatatcaag
actttcaacgaactcagaccaggtcttatcctctggtggatactcgatatctctctggca
tgcagacagttggccacctttggccagctgaccgactcgatgattcttgtcgtcgcgttc
cacggctggtatgtgtttgatgcactgtacaatgagtcaatcattctcacccaaatggat
attgttcatgacgggtttggttacatgttggccttcggcgatctcacctgggtgcctttc
acatactccctgcaagcccgctttcttgcataccatccaaatattttaggtccatctgga
agtgctgcaattgccgctttgcagctgttaggttattacatcttccgcacatccaacgcc
gagaagaacgagttcaggaatggcaagaatccaaagaacctccagtacatgcaaaccaag
aggggtactaagctactcacgtctggatggtggggtacactgagacaccccaactacctc
ggcgatctcataatggcgttggcgtggagtctcccaactggttcactcacaccattgacc
tatttctacccagcttacttcaccgtcttgctcatccatagagctcttcgtgatgatgca
cactgtcgagagaagtatggcgatgattggaatgcgtacgttgagaaagtgccgtactgc
atattcccgtatgtgttctga

DBGET integrated database retrieval system