KEGG   Wallemia ichthyophaga: J056_000817Help
Entry
J056_000817       CDS       T03457                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
wic  Wallemia ichthyophaga
Pathway
wic00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
wic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    J056_000817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 20373769
NCBI-ProteinID: XP_009268720
UniProt: R9ADM0
Position
Unknown
AA seq 499 aa AA seqDB search
MISWLILLLLIGLAACRDSKDGFDEFLSIKPLQDGRVDTAFNFTISDQDISPHSHLFPLP
LVNLLTSPELDIDELHLSLSAGRWDYDKWHYPTFPQLGSSGAEVWVSHKSDRSQEKWNRV
VHRISGLFCASLSTSDNTNHLLLDDKTWTYAQISSQLPCTENLTPFIALLPCKSAAGLGQ
LLNPHKIFDADYHSLALSMFNQGSGARLEIKVEAVFNPARVDQQRQYSTKAMFDRTVKQK
CELADSSMVYFGLPPPPGEELNQDVWVVLPEDHEGEVKDGTIELDLMTTSKQLGLALIWP
FQETFIYPRYTTKPPIQIRRDQIAGPVEETFTMKITIENTQDEDAQVSYLQSIPWQVKPW
LHTFRIYGDSSSDSTSFKHNQAKADKEPYSLQVNTTLAPHSETIIECIYQRQFLKYTDYA
PDIHRGIDIPPGFIRFEADNMTKVAYTTPMLVDLATPDFSMPYNVIIITSTVVALFFGSV
YNILVRDFQLIPKKESKSD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgataagctggctaattttgctccttctcattggattagcagcttgtagagacagcaag
gacggctttgatgaatttctctccataaaacctctacaggatggaagagtagacactgca
ttcaatttcactatcagcgatcaggatatttcacctcactctcaccttttcccgcttcca
ctcgtcaacctcctcacttcacctgaactcgatatcgatgagcttcatctgagtctgtca
gcgggtagatgggactatgataagtggcattatcctacattccctcaactgggcagctcc
ggtgcagaagtctgggtgtcacacaagtctgacagatcgcaagagaaatggaatcgtgtc
gtacacaggatatcaggactattctgcgcatcacttagcacatcagataacaccaatcac
ttgcttctcgatgataagacatggacatatgctcaaatatcttcacagctgccttgcaca
gagaatcttacaccttttatcgcactgttgccttgcaaaagcgctgctggattgggtcaa
ttactcaaccctcacaagatattcgacgctgattatcacagtctggccttatcaatgttc
aatcaaggcagtggcgctcgtttagaaattaaagtcgaagcagtctttaatcctgctcga
gttgatcaacaaaggcagtactcaactaaagccatgttcgatagaacagtcaaacaaaaa
tgtgagttggcggatagcagcatggtgtactttggtcttccacctccgcctggtgaagaa
ctcaatcaagatgtgtgggtggtgcttccagaggatcatgaaggagaggtcaaagatgga
acaatagagctggacttgatgacaacatcaaaacaactcggattagcattaatttggcca
ttccaggaaactttcatatatcctagatacactaccaaaccccctatacagattcgaaga
gatcagatagcaggtccagtagaggagacattcacgatgaaaataactatagaaaacact
caggacgaggacgcgcaagtcagctacctgcaatcaataccctggcaagtcaaaccatgg
ttacataccttcagaatatatggcgatagtagtagtgattcaacctcctttaagcacaac
caagctaaagctgataaagaaccgtattcactccaagtaaacaccacacttgcaccacat
tcagaaaccataatcgagtgtatctatcagcgccaatttctcaagtacacagattacgca
cctgacattcaccgtggcatcgacataccacccggatttatacgtttcgaagcagacaac
atgacaaaagtagcatacacgacaccaatgttggttgatctagcaacaccagacttttca
atgccgtacaacgtgattataataaccagcacagtcgtagctctcttcttcggtagcgta
tacaacatactagtacgtgacttccaattaattcctaagaaagaatcaaaatcagactga

DBGET integrated database retrieval system