KEGG   Wallemia ichthyophaga: J056_001533Help
Entry
J056_001533       CDS       T03457                                 

Definition
(RefSeq) Thiamine thiazole synthase
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00730  Thiamine metabolism
wic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    J056_001533
Enzymes [BR:wic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     J056_001533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 Lycopene_cycl NAD_binding_9 FAD_oxidored HI0933_like Trp_halogenase Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-GeneID: 20374485
NCBI-ProteinID: XP_009269436
UniProt: R9AC18
Position
Unknown
AA seq 317 aa AA seqDB search
MAPVQAAQQPANIQQLKQQAKAHADSNEDYNGNYSFAPIKEYETSRAMTTRYFNDMYDRA
ISDVLIVGAGSAGLSCAFTIATERPDLKVTIVESAVAPGGGAWLGGQLFSAMVVRKPAHN
FLDKVGVPYEDEGRFVVVKHAALLTSTLLAKTLALPNVKLFNATACEDLMVKKDFEGKQR
VTGIVSNWTLVSLNHDTQSCMDPNTITSPVTISFCGHDGPFGAFSVKRLASAGFVELGDM
RALDMNKSEDQIVNQTREVFPGLVVGGMELSELDGAPRCGASFGGMFGSGVRAAHTAIES
LKSSEIVEGEVTGRVAA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagttcaagcagcacaacaaccagctaacatccagcaactcaagcaacaagct
aaagcccacgccgattctaacgaagactacaatggcaactacagcttcgcaccaatcaag
gagtatgagacatctagagcaatgacaacgcgctactttaacgacatgtacgacagagcc
atctctgatgtattgatcgtcggtgctggtagcgctggtctatcatgcgcattcacgatt
gccaccgagagacccgatctcaaggtgacaatcgtcgaatcagcagttgctccaggtggc
ggtgcttggctcggaggtcaacttttttcagcaatggttgtacgcaaaccagcgcacaat
ttccttgataaggttggcgtcccatacgaagacgaaggtcgctttgttgttgtcaagcac
gcagctctcctcacttcaactcttctcgccaagactctggcccttcctaacgtcaagctc
ttcaacgcgactgcgtgtgaagatcttatggtgaagaaagactttgaaggaaagcaacgt
gttactggtatcgtgtccaactggacgttagtttcgcttaaccatgacactcaatcttgc
atggatccaaacaccattacctcaccagtgaccatctcattctgcggccacgacggtcct
ttcggtgctttctctgtcaagagacttgcttcggctggatttgttgagctcggcgatatg
agggcactcgatatgaacaagagtgaagatcaaattgtcaaccaaactagggaagttttc
ccaggtttggtcgttggtggtatggagttgtccgaattagacggtgctcctcgctgcggt
gcctcgtttggtggtatgtttggctctggtgttagagctgctcacactgccatcgagtcg
cttaagtcatctgaaattgtcgaaggtgaagtcactggcagagttgctgcttaa

DBGET integrated database retrieval system