KEGG   Wallemia ichthyophaga: J056_003708Help
Entry
J056_003708       CDS       T03457                                 

Definition
(RefSeq) Mitogen-activated protein kinase HOG1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
wic  Wallemia ichthyophaga
Pathway
wic04011  MAPK signaling pathway - yeast
wic04139  Mitophagy - yeast
wic04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:wic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    J056_003708
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    J056_003708
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    J056_003708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:wic01001]
    J056_003708
Enzymes [BR:wic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     J056_003708
Protein kinases [BR:wic01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   J056_003708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 20376660
NCBI-ProteinID: XP_009267199
UniProt: A3EZ55
Position
Unknown
AA seq 522 aa AA seqDB search
MFHLLSRSEMFREVLEGGGGSAEEDKDIEIQTTETNKQLDDYIRLITSAQLPDNSLIYFK
DLLQLTDKYKDITSTKIIEQHLIISSSEFNKLDLYSCACRFQLSNLKSNQLNLINKEDLG
ELSEDSNLGSVDLYDLIKHSHKDRKFEDPVETRTPPIMSQEDSSFVKLSVFGNIFQVTTR
YTDLQPVGMGAFGLLCSSTDQKSGGPVAIKKVMKPFSAPVLAKRTYRELKLLKHLRHENI
ISLLDVFISPGEDIYFITELLGTDLHRLLSSRPLERQFVQYFLYQMLRALKFVHPAGVVH
RDLKPSNILINENCDLKICDFGLARLQDPQMTGYVSTRYYRAPEIMLTWQEYDSAVDIWS
VGCIFAEMIDGRPIFPGKDHVHQLTVITELLGSPPEDVINTITSENTRRFVDALPKRHKI
SFADRFPNANAEEIDLLEKMLDFNPKKRITAADALAHPYLAPYHDPEDEPTANERFDWSF
NDADLPTDQWKVMMYSEILDFHNVDVKSEKDMTPSTTTAGAH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttccacttgcttagcaggagcgagatgtttagggaggtgctggaaggtggtggtggg
agtgctgaggaggacaaggacattgaaatacaaactacagaaacaaataagcagctggat
gattatatcaggttgattaccagtgcccagctgcccgataacagcctcatttactttaaa
gatctacttcaacttacagacaaatacaaggacataacatcgaccaagataattgagcag
cacctgataatatcctcaagcgaattcaacaaactcgatttatactcgtgtgcgtgtcga
ttccaactcagcaacctcaaatcaaaccagcttaatctgataaacaaggaagatctcggt
gagctatccgaagactcgaacctcggctccgtcgacctatacgacctcatcaaacactcc
cacaaagaccgaaaatttgaagatcctgttgagactcgcactcctccaatcatgtcccaa
gaagacagcagtttcgtcaagcttagtgtgtttggtaatatattccaagtcaccaccagg
tataccgacctgcagcctgttggcatgggcgctttcggtctcctctgctcctccactgac
cagaagtccggtggccctgtcgccataaaaaaagtcatgaagcccttctccgcgcccgta
ctcgcaaaacgcacttaccgcgaactaaaactcctgaaacacctccgccatgagaacatc
atttccttgttagacgttttcatttccccaggcgaggatatctactttatcactgaattg
ctcggtactgacctccaccgtcttctctcctcacgccccctcgaaaggcagttcgttcag
tatttcctctaccagatgctccgtgctcttaaattcgtacacccagctggcgtcgtccac
cgcgacttgaaaccttccaacatcctcatcaacgaaaactgcgacctcaaaatctgtgat
ttcggtttggccaggttgcaagatccccagatgactggttatgtctctacgaggtactac
agggcacctgagatcatgcttacttggcaagagtacgattccgccgttgatatttggtct
gtcggttgcatttttgccgaaatgatcgacggcagacccatcttccccggcaaagaccac
gtccatcagctcaccgtcatcaccgagctgctcggctcaccgcctgaggatgtcatcaac
accatcacatccgaaaacactcgccgtttcgtagacgctttaccaaagagacacaaaatt
tccttcgccgaccgcttccctaatgccaacgcggaggagatcgacttgctggaaaaaatg
ctcgactttaaccccaagaagagaattacagccgcagacgccctcgctcacccttacctc
gctccttaccacgatccagaagatgaacctacggctaacgaacgcttcgattggtcgttc
aacgacgctgatctccctactgatcagtggaaggtgatgatgtactctgagatactcgac
ttccacaacgtcgacgtcaagtcggagaaggatatgactcctagcactaccaccgctggt
gctcactag

DBGET integrated database retrieval system