KEGG   Wallemia ichthyophaga: J056_004210Help
Entry
J056_004210       CDS       T03457                                 

Definition
(RefSeq) Calcium/calmodulin-dependent protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
wic  Wallemia ichthyophaga
Brite
KEGG Orthology (KO) [BR:wic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:wic01001]
    J056_004210
Enzymes [BR:wic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     J056_004210
Protein kinases [BR:wic01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   J056_004210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 20377162
NCBI-ProteinID: XP_009267686
UniProt: R9AGR7
Position
Unknown
AA seq 393 aa AA seqDB search
MGFLRDTLLPQPESYYKKKSYNFGEVLGEGAFGKVVRAEWDNHPDGKQDVAVKVISKKKA
QGNESAIFDETNLLKHLNHPNIVSFYEWYESRDTWYLSFQLATGGELFDRIARKGRFTEK
NAATVIMSIVDATAYMHSNNVVHRDIKPENILYKSKDAGSGVVIADFGISQRLDSHNAQI
TSLAGSVGYAAPEILNNDAHSKPVDLWAIGVVTYVLLCGYSPFRSEELSELIKETNRGKI
EFHERYWSKVSDHAKDFVKALLQPDPSKRLTAEQALNHQWFKDQNLSEHDVSEGLRDAFN
SREKWRSAIRAVTAMSRFSKLGQNASERAQENSDAQNGSIVSQDSQDFKKFDFSSDRSLD
ASVAANAANSKPASEVHEANVSDYESASEDFAT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttaagggacacattgctgccacaaccagaatcttattacaagaagaagagc
tacaattttggtgaagttttaggagaaggtgcatttggaaaggtcgtacgagccgagtgg
gataaccatccagatggaaagcaggacgttgccgttaaagtgatttccaagaaaaaggct
caggggaatgagagtgccatatttgatgagactaatctactcaaacatcttaatcatccc
aatatcgtttctttctacgagtggtatgaatcgagagacacttggtacctcagtttccaa
cttgccactggcggtgagctatttgatagaatcgctcgtaagggaaggtttaccgagaaa
aacgctgcgaccgttatcatgtctattgtcgatgctactgcatatatgcactcaaataat
gtcgtgcatcgcgatataaaacctgaaaatattctctacaaaagtaaagatgctggctct
ggcgttgttattgccgattttggtatttctcagcgtttagacagtcataacgctcaaatt
acctcacttgctggctctgtcggttatgctgctccagagatactcaacaacgatgctcac
agtaagcctgttgacctctgggccatcggtgtcgtcacttatgtcttattatgtggttac
tctcccttccgttctgaagaactgagtgagttgattaaagaaactaacagaggaaagatt
gagttccacgaaagatactggtctaaagtcagcgatcatgcaaaggactttgttaaagct
ctgttgcaacccgacccatccaaaagactcacagctgagcaagcgctcaaccaccagtgg
ttcaaagatcaaaatctctctgaacacgatgtgagtgaaggtttgcgggatgcattcaac
agtcgcgagaaatggagaagcgctattagagcagttacggccatgtctagatttagcaag
ctgggtcaaaacgcttctgaaagagctcaagaaaattccgatgcgcagaatggctctatt
gtctctcaagattctcaagacttcaagaaattcgacttcagttctgatcgttccttggac
gcttcagtagcagccaacgcagccaatagcaaacctgccagtgaagtccacgaggcaaat
gtgtcggattatgaaagtgccagtgaggattttgcgacataa

DBGET integrated database retrieval system