KEGG   Wallemia ichthyophaga: J056_004217Help
Entry
J056_004217       CDS       T03457                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
wic  Wallemia ichthyophaga
Pathway
wic00020  Citrate cycle (TCA cycle)
wic00640  Propanoate metabolism
wic01100  Metabolic pathways
wic01110  Biosynthesis of secondary metabolites
wic01130  Biosynthesis of antibiotics
wic01200  Carbon metabolism
Module
wic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
wic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J056_004217
   00640 Propanoate metabolism
    J056_004217
Enzymes [BR:wic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     J056_004217
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     J056_004217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA Cytidylate_kin2
Motif
Other DBs
NCBI-GeneID: 20377169
NCBI-ProteinID: XP_009267693
UniProt: R9AMV7
Position
Unknown
AA seq 327 aa AA seqDB search
MFKNLVNSVGRRSLSTSARRTNNLYDQSIPNLAVNKDTRVLCQGFTGKTATFHCREAISY
GTNMVGGVSPSKAGTEHLGLPVFGSVKEAAREAKPDATVLYVPPPFAANAIIEAIENEIG
LIVAITEGIPQADEIKVAHVLRQQTKSRLLGPNCPGVINPDGCKIGIMPGYIHSPGKVGI
VSRSGTLTYEAVQQTSEVGLGQSICLGIGGDPFPGTTHVDALKLLLHDPKTEAVVLIGEI
GGSSEEEAAEYIKQNNIHNKPIVGFIAGVSAPPGRRMGHAGAVISGGGVGKAETKINALR
NAGAVVVESPGEIGAAILKSAKAAGIA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaatcttgtaaacagcgtcggtcgccgctctcttagcacctctgctagacgc
acgaacaacctctacgaccaatccatcccaaacctcgctgtaaataaggacactagagtt
ctctgtcaaggattcacaggtaaaactgctaccttccactgcagagaagccatttcgtac
ggtaccaacatggttggcggtgtcagtccttcaaaggcaggcactgagcacttgggttta
cctgtcttcggatctgtcaaggaagctgcccgtgaagctaaacctgatgctaccgtcctc
tacgttcctcctcctttcgctgccaatgctataatcgaagccatcgagaatgaaatcggc
ttgatcgtcgctattactgaaggtatccctcaagctgatgaaatcaaggttgctcacgta
ctccgccaacaaactaaatctcgtcttcttggtccaaactgccctggtgtcataaatcct
gacggctgcaagattggtatcatgcctgggtacatccactcaccaggaaaggtcggtatc
gtgtctagatctggtactctcacttatgaagctgtccaacaaacctctgaagtcggtttg
ggtcaatctatctgtttgggtattggtggtgatcctttcccaggtaccacccacgtcgat
gcccttaaactcttgcttcacgatccaaagactgaggctgtcgttttgattggtgagatt
ggtggttcatctgaagaagaagctgcagaatacatcaagcaaaacaatattcacaacaag
ccaattgtcggtttcatcgctggtgtttcagctccacctggccgtagaatgggtcacgct
ggtgctgtcatctctggtggtggtgtcggtaaggctgagactaagattaacgctctcaga
aacgcaggtgcagttgttgttgagtccccaggtgaaattggtgctgctattctcaaatca
gctaaggccgctggtatcgcgtaa

DBGET integrated database retrieval system