KEGG   Winogradskyella sp. J14-2: BWZ20_11055Help
Entry
BWZ20_11055       CDS       T04714                                 

Definition
(GenBank) glycosyl hydrolase family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
wij  Winogradskyella sp. J14-2
Pathway
wij00511  Other glycan degradation
wij00600  Sphingolipid metabolism
wij01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wij00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BWZ20_11055
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BWZ20_11055
Enzymes [BR:wij01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BWZ20_11055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: APY08802
UniProt: A0A1P8RY01
Position
2464609..2466096
Genome map
AA seq 495 aa AA seqDB search
MKALRISVYCLLIAAMSCNTQPEELKVEVLETSASGNQLTKVEPLAVDEEVDAMHVIRIL
PDQRFQTITGFGGAFTESSAYLLNKLSPKNRDLILKAYFSQEGANYSLCRTHMNSCDFSL
GHYSYTPTEDKELKDFSVKEDMDDLIPMIKDAQAISKDGFKLFASPWTAPPWMKDNKDWV
GGKLLPEYYPSWALFFSKYIEAYKDQGIELWGFTVENEPHGNGNNWESMHFTPEEMTDFV
QHHLGPKLEADGYGDKIILGYDQNRAGIKEWVDVMYATEASSKYYDGTAIHWYESTYEVF
PEDLQYAHNKAPDKYLIETEGCIDDEVPVWKDDAWYWKKEATDWGWKWASEKDKYLHPKY
APANRYARDIIGCLNNWVDGWVDWNMVLNKQGGPNWFKNWCIAPVIVDEVNDEVYFTPLY
YIMTHFSKYIRPEAKVLGIDKTDNDIMATAVENPDGSVILVVFNENNEAKKFHLWLNGKR
TTIYINRQAIQTIVM
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaagaattagtgtttattgtcttttaatagcagctatgagttgtaatacc
caaccagaagagttaaaagttgaggttttggaaacttcagcaagtggaaaccaattaact
aaagttgagcctttggctgtagatgaggaagttgatgcaatgcatgtaataagaattctg
ccagatcaaagatttcaaactattacaggatttggaggagcatttacagagtcgtcagca
tatttgctcaataaattgagtccaaaaaatagagatcttattttaaaagcttatttcagt
caagaaggcgcaaactattcattatgtagaacacatatgaactcttgtgatttttcatta
ggccattattcttacacaccaactgaagataaagagttaaaagacttctctgttaaggaa
gatatggatgatttaatcccaatgattaaagatgctcaagcgatttctaaagatgggttt
aaattgtttgcttcaccatggacagcaccaccatggatgaaagacaacaaagattgggta
ggtggtaagttattgccagagtattacccaagttgggcactgttcttttcaaaatatata
gaagcctataaagaccaaggtatagagctttggggttttactgtagaaaatgaacctcat
ggcaacggcaacaattgggaaagtatgcactttacaccagaagaaatgactgattttgtt
cagcatcatttaggcccaaaattagaagctgatggttatggtgataaaatcattttaggt
tacgatcagaatagagcaggaataaaagaatgggtagatgtaatgtatgcaaccgaagcg
tcttcaaaatattatgacggaacagcaattcactggtatgaaagtacttatgaggtcttt
ccagaagatcttcaatatgcccacaataaagcaccagataaatatcttatagaaaccgaa
ggttgtatagatgatgaagtgcctgtttggaaagacgatgcttggtattggaaaaaagaa
gcgactgattggggctggaaatgggcatctgaaaaagataagtatttacaccctaaatat
gcaccagcaaatcgctatgcaagagatattataggttgtctaaacaattgggtagatggt
tgggtagattggaatatggttctaaacaagcaaggtggcccaaattggtttaaaaactgg
tgtattgctccagtaattgtagatgaggtaaatgatgaggtatactttacgccattgtat
tacataatgacgcacttcagcaagtatataaggccagaagctaaggttttaggtatagat
aaaacggataatgacattatggccacagcagtagaaaatcctgatggctccgtaattctt
gtagtatttaatgaaaataatgaagctaagaaatttcacctatggctcaatggcaaaagg
actactatatatataaaccgacaggctattcaaactatagtaatgtag

DBGET integrated database retrieval system