KEGG   Winogradskyella sp. J14-2: BWZ20_14510Help
Entry
BWZ20_14510       CDS       T04714                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
wij  Winogradskyella sp. J14-2
Pathway
wij00480  Glutathione metabolism
wij00590  Arachidonic acid metabolism
wij01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wij00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BWZ20_14510
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BWZ20_14510
Enzymes [BR:wij01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BWZ20_14510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin LPD28 AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: APY09438
UniProt: A0A1P8RZU3
Position
complement(3235712..3236251)
Genome map
AA seq 179 aa AA seqDB search
MNPLKTFVGTLSTSDNKIKHKATASIYDIEINSLAGKPIKLSEFKGKKILFVNVASKCGF
TPQYRALQELSDSYKDKLVVIGNPCNQFGGQEPGNADEIQEFCKVNYGVTFLITEKIDVK
GSNQHPLYKWLTSKRLNGKQNSTVKWNFQKYLIDEHGEFIDYFYSITKPTNSRITKHLK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactaaaaacatttgtaggtacgctaagtacatcagacaataagataaagcat
aaagcaacagcctctatatatgatatagaaattaatagcttagcaggaaaaccgataaaa
ctatctgaatttaaggggaagaaaattctttttgttaacgtggcttcaaaatgtggtttt
actccacagtacagagcattacaagagctttctgattcttataaggataaattggtagtt
ataggtaatccatgcaatcaatttggtgggcaagagccaggtaatgcagacgaaatccaa
gagttttgtaaagttaattatggtgtaacgtttttaattacagaaaaaatagatgtaaaa
ggaagcaatcaacatcctctatataaatggctcacatcaaaacgtctaaatggaaagcaa
aactctactgtaaaatggaactttcaaaaatatttgattgacgagcatggtgagtttatc
gattacttctactccattactaaacctacaaattctaggattacaaaacatctaaaataa

DBGET integrated database retrieval system