KEGG   Winogradskyella sp. PG-2: WPG_2011Help
Entry
WPG_2011          CDS       T03603                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
win  Winogradskyella sp. PG-2
Brite
KEGG Orthology (KO) [BR:win00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WPG_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAO76241
UniProt: A0A024FH31
Position
complement(2226721..2227107)
Genome map
AA seq 128 aa AA seqDB search
MVQQVTSGIKISVETNFEGTFYKNYKVHFAFGYKVTIENQSKDSVQLNTRHWKILDALNN
EEIIEGEGVIGKKPVLKPGESHTYNSGCLLTSPFGAMRGHYNMVNFTKANKFKVYIPTFK
LSAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtacaacaagttacaagcggaattaagatttctgtggaaaccaattttgaaggtaca
ttttataagaactataaagtgcacttcgcctttggttataaagtaactattgagaaccag
agtaaagattctgttcaacttaatacaagacactggaaaattcttgatgctctcaacaat
gaagaaataattgaaggagaaggtgttattggtaaaaagccagttttaaaacctggtgag
tctcacacttataattccggctgtctattaacttcaccatttggagctatgcgtggccat
tataacatggtcaatttcaccaaagctaataagtttaaggtttatatccctacctttaaa
ttaagtgctccttttgcgcttaactaa

DBGET integrated database retrieval system